KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2161
Entry
SAS2161           CDS       T00183                                 

Definition
(GenBank) putative molybdopterin-synthase large subunit
  KO
K03635  molybdopterin synthase catalytic subunit [EC:2.8.1.12]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00790  Folate biosynthesis
sas01100  Metabolic pathways
sas01240  Biosynthesis of cofactors
sas04122  Sulfur relay system
Module
sas_M00880  Molybdenum cofactor biosynthesis, GTP => molybdenum cofactor
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAS2161
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SAS2161
Enzymes [BR:sas01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.12  molybdopterin synthase
     SAS2161
SSDB
Motif
Pfam: MoaE AhpC-TSA
Other DBs
NCBI-ProteinID: CAG43972
GeneDB: SAS2161
UniProt: Q6G751
Structure
PDB: 
2Q5W 2QIE

Position
complement(2318826..2319272)
AA seq 148 aa
MKQFEIVTEPIQTEQYREFTINEYQGAVVVFTGHVREWTKGVKTEYLEYEAYIPMAEKKL
AQIGDEINEKWPGTITSIVHRIGPLQISDIAVLIAVSSPHRKDAYRANEYAIERIKEIVP
IWKKEIWEDGSKWQGHQKGNYEEAKREE
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaacaatttgaaatcgtgacagaaccgatacaaacagaacaatatcgtgaattcact
ataaatgaatatcaaggtgcagtagttgtttttaccggtcatgttcgcgaatggactaaa
ggcgtcaaaacggaatatttagaatatgaagcgtatattccaatggctgaaaagaaattg
gcacaaattggagatgaaataaatgaaaaatggcctggaacgataacgagtattgttcat
agaatagggccattacaaatttcagatatcgctgtattaattgcggtttcttcaccgcat
cgtaaagatgcctatcgagcaaatgaatatgcaattgagcgtataaaagaaattgttccg
atttggaaaaaagaaatttgggaagatggttcaaaatggcaagggcatcaaaaagggaat
tatgaagaagcgaagagggaggaataa

DBGET integrated database retrieval system