KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0358
Entry
SAS0358           CDS       T00183                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit C
  KO
K24119  NADH-dependent peroxiredoxin subunit C [EC:1.11.1.26]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Brite
KEGG Orthology (KO) [BR:sas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SAS0358
Enzymes [BR:sas01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.26  NADH-dependent peroxiredoxin
     SAS0358
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC NAGidase
Other DBs
NCBI-ProteinID: CAG42129
GeneDB: SAS0358
UniProt: Q6GC91
Position
complement(402266..402835)
AA seq 189 aa
MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQY
EELQKLGVNVFSVSTDTHFVHKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLA
QRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYVRKNPGEVCPAKWEEGAKTLQ
PGLDLVGKI
NT seq 570 nt   +upstreamnt  +downstreamnt
atgtcattaattaacaaagaaatcttaccatttacagcgcaagctttcgatccaaaaaaa
gatcaatttaaagaagttacacaagaagatttaaaaggttcttggagcgtagtatgcttc
tatcctgctgacttctcattcgtttgtccaactgaattagaagacttacaaaaccaatat
gaagaattacaaaaattaggcgtaaatgtattctcagtatcaactgatactcacttcgta
cacaaagcatggcatgaccattcagatgcaattagcaaaatcacttacactatgattggt
gacccatcacaaacaatcactcgtaattttgatgtattagatgaagctactggtttagct
caacgtggtacattcattatcgacccagacggtgttgtacaagcatctgaaattaacgct
gacggaattggccgtgacgctagtacattagctcacaaaatcaaagcagctcaatatgtt
cgtaaaaaccctggcgaagtatgcccagctaaatgggaagaaggcgctaaaacattgcaa
cctggtttagatttagtaggtaaaatctaa

DBGET integrated database retrieval system