KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0534Help
Entry
SAS0534           CDS       T00183                                 

Definition
(GenBank) putative ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00071  Fatty acid degradation
sas00072  Synthesis and degradation of ketone bodies
sas00280  Valine, leucine and isoleucine degradation
sas00310  Lysine degradation
sas00362  Benzoate degradation
sas00380  Tryptophan metabolism
sas00620  Pyruvate metabolism
sas00630  Glyoxylate and dicarboxylate metabolism
sas00640  Propanoate metabolism
sas00650  Butanoate metabolism
sas00900  Terpenoid backbone biosynthesis
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01120  Microbial metabolism in diverse environments
sas01130  Biosynthesis of antibiotics
sas01200  Carbon metabolism
sas01212  Fatty acid metabolism
sas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SAS0534
   00630 Glyoxylate and dicarboxylate metabolism
    SAS0534
   00640 Propanoate metabolism
    SAS0534
   00650 Butanoate metabolism
    SAS0534
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SAS0534
   00072 Synthesis and degradation of ketone bodies
    SAS0534
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SAS0534
   00310 Lysine degradation
    SAS0534
   00380 Tryptophan metabolism
    SAS0534
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SAS0534
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SAS0534
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SAS0534
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sas04147]
    SAS0534
Enzymes [BR:sas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SAS0534
Exosome [BR:sas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAS0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CAG42309
GeneDB: SAS0534
UniProt: Q6GBR1
Position
617858..618997
Genome map
AA seq 379 aa AA seqDB search
MNQAVIVAAKRTAFGKYGGTLKHLEPEQLLKPLFQHFKEKYLEVISKIDDVVLGNVVGNG
GNIARKALLEAGLKDSIPGVTIDRQCGSGLESVQYACRMIQAGAGKVYIAGGVESTSRAP
WKIKRPHSVYETALPEFYERASFAPEMSDPSMIQGAENVAKMYDVSRELQDEFAYRSHQL
TAENVKNGNISQEILPITVKGEIFNTDESLKSHIPKDNFGRFKPVIKGGTVTAANSCMKN
DGAVLLLIMEKDMAYELGFEHGLLFKDGVTVGVDSNFPGIGPVPAISNLLKRNQLTIENI
EVIEINEAFSAQVVACQQALNISNTQLNIWGGALASGHPYGASGAQLVTRLFYMFDKETM
IASMGIGGGLGNAALFTRF
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaagcagtcatagttgcagctaaacgaactgcatttgggaaatatggtggcact
ttaaaacatttagagccagaacaattgcttaaacctttattccaacattttaaagagaag
tatctagaggtaatatctaaaatagatgatgtagttttaggtaatgttgttgggaatggt
ggcaatattgcaagaaaagcattgcttgaagcggggcttaaagattcaatacctggcgtc
acaatcgatcggcaatgtgggtctggacttgaaagtgttcaatatgcatgtcgcatgatc
caagccggagctggcaaggtatatattgcaggtggtgttgaaagtacaagtcgagcacct
tggaaaatcaaacgaccgcattctgtgtacgaaacagcattacctgagttttatgagcgt
gcatcatttgcacctgaaatgagcgacccatcaatgattcaaggtgctgaaaatgtggcc
aagatgtatgatgtttcaagagaattacaagatgaatttgcttatcgaagtcatcaattg
acagcggaaaatgtaaagaatggaaatatttctcaggaaatattacctataaccgttaaa
ggagaaatattcaacactgatgaaagtctaaaatcacatattccgaaagataactttggc
cgatttaagcccgtgatcaaaggtgggaccgttaccgctgcgaatagttgtatgaaaaat
gatggtgcagttttattgcttattatggaaaaagatatggcatacgaattaggtttcgag
catggtttattatttaaagatggtgttacggtaggtgttgattctaattttcctggcatt
ggtccagtaccagccatttccaacttactaaaaagaaatcaattaacgatagaaaatatt
gaagtcattgaaattaacgaagcgttcagtgcacaggtagttgcctgccaacaagcttta
aatatttcaaatacgcaattaaatatatggggtggtgcattagcatcaggtcatccatac
ggtgcaagcggtgcccaattagtgactcgattattttatatgtttgacaaagagactatg
attgcatctatggggatagggggaggtctaggaaatgcagcattatttactcgattctaa

DBGET integrated database retrieval system