KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1238Help
Entry
SAS1238           CDS       T00183                                 

Definition
(GenBank) putative glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00480  Glutathione metabolism
sas00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SAS1238
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAS1238
Enzymes [BR:sas01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAS1238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: CAG43016
GeneDB: SAS1238
UniProt: Q6G9Q8
Position
complement(1332084..1332560)
Genome map
AA seq 158 aa AA seqDB search
METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVIL
GFPCNQFGGQEPGSGEEAAQNCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNE
KIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggagacaatttatgattttgtagtagaaacaaataaaggtgttacttacaaattagat
gcatataagggtgacgttatgctaattgttaatacagctagcgaatgtggctttacttca
caatttgaaggtttgcaatcattatacgagaaatacaaagatcaagggtttgtaattcta
ggtttcccttgtaatcaatttggtggccaagaacctggatcaggcgaagaagcagctcaa
aactgtaaattaaactatggtgttaccttccctatgcatcaaaaaatagacgtaaaaggg
gaacatcaattacctttatttagatatttgactgcggcacaacacggattctttaatgag
aaaatcaaatggaatttcactaagtttttagtggatcgcgaaggtaacgttgttaaacga
tttgcacctcaaaaaaaacctgttcaaatcgaaagagaaatagaaaaattattataa

DBGET integrated database retrieval system