KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1310Help
Entry
SAS1310           CDS       T00183                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01130  Biosynthesis of antibiotics
sas01230  Biosynthesis of amino acids
Module
sas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAS1310
Enzymes [BR:sas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     SAS1310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh BBE His_biosynth
Motif
Other DBs
NCBI-ProteinID: CAG43087
GeneDB: SAS1310
UniProt: Q6G9I9
Position
1406083..1406865
Genome map
AA seq 260 aa AA seqDB search
MTILSEIVKYKQSLLQNGYYQDKLNTLKSVKIQNKKSFINAIEKEPKLAIIAEIKSKSPT
VNDLPERDLSQQISDYDQYGANAVSILTDEKYFGGSFERLQALTTKTTLPVLCKDFIIDP
LQIDVAKQAGASMILLIVNILSDKQLKDLYNYAISQNLEVLVEVHDRHELERAYKVNAKL
IGVNNRDLKRFVTNVEHTNTILENKKTNHYYISESGIHDASDVRKILHSGIDGLLIGEAL
MRCDNLSEFLPQLKMQKVKS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacgattttatcagaaattgttaaatataaacagtcacttttacaaaatggctattat
caagacaaacttaataccttgaaaagtgtgaagattcagaataaaaaatcttttataaac
gcaattgagaaagaaccaaagctagcaattattgcagaaattaaatcgaagagtcctaca
gttaatgacttacctgaacgagatttatcgcaacaaatctcagattatgaccaatatggt
gcaaatgccgtgtccattttaactgatgaaaagtactttggtggtagttttgaaagatta
caagcattgacgacaaaaacaacattacccgtattatgcaaagactttattatagacccg
cttcaaattgatgttgctaaacaagctggtgcatctatgattttattgatcgttaacatc
ttatctgataaacaattgaaagatttatataactacgctatatcgcaaaatctagaagtg
ttagttgaagtacatgatcgccatgaattagaacgtgcctataaggttaatgctaaattg
attggtgtaaataacagggacttaaaacgatttgttacaaatgtggaacatacaaatact
attttagaaaataaaaaaacaaatcattattatatttctgaaagtggtattcacgatgca
tctgatgtaagaaaaatcttgcatagtggtatcgatggcttactaataggtgaggcgctt
atgcgttgtgacaatctatctgaatttttaccacaactgaaaatgcaaaaggtgaagtca
tga

DBGET integrated database retrieval system