KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1355Help
Entry
SAS1355           CDS       T00183                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase E2 component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00020  Citrate cycle (TCA cycle)
sas00310  Lysine degradation
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01120  Microbial metabolism in diverse environments
sas01130  Biosynthesis of antibiotics
sas01200  Carbon metabolism
Module
sas_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sas_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SAS1355
  Amino acid metabolism
   00310 Lysine degradation
    SAS1355
Enzymes [BR:sas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SAS1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 IF3_N
Motif
Other DBs
NCBI-ProteinID: CAG43130
GeneDB: SAS1355
UniProt: Q6G9E9
Position
complement(1449133..1450401)
Genome map
AA seq 422 aa AA seqDB search
MPEVKVPELAESITEGTIAEWLKNVGDSVEKGEAILELETDKVNVEVVSEEAGVLSEQLA
SEGDTVEVGQAIAIIGEGSGNASKENSNDNTPQQNEETNNKKEETTNNSVDKAEVNQAND
DNQQRINATPSARRYARENGVNLAEVSPKTNDVVRKEDIDKKQQAPASTQTTQQASAKEE
KKYNQYPTKPVIREKMSRRKKTAAKKLLEVSNNTAMLTTFNEVDMTNVMELRKRKKEQFM
KDHDGTKLGFMSFFTKASVAALKKYPEVNAEIDGDDMITKQYYDIGVAVSTDDGLLVPFV
RDCDKKNFAEIEAEIANLAVKAREKKLGLDDMVNGSFTITNGGIFGSMMSTPIINGNQAA
ILGMHSIITRPIAIDQDTIENRPMMYIALSYDHRIIDGKEAVGFLKTIKELIENPEDLLL
ES
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccagaggttaaagttccagaattagcagaatctattacagaaggtaccattgcagaa
tggttgaaaaacgtaggggatagcgtagaaaaaggtgaagctattcttgaattagaaact
gataaagttaatgtcgaagttgtatctgaagaagcaggtgtattatctgaacaacttgca
agtgaaggcgacactgtagaagttggacaagcaattgctatcatcggcgaaggtagtggc
aatgcttctaaagaaaatagtaacgacaatactccacaacaaaatgaagaaacaaataat
aaaaaagaagaaacaacaaataattcggtagataaagctgaagtaaatcaagcaaatgat
gacaatcagcaacgtattaatgctacgccttctgcgcgtcgatatgctcgtgaaaatggt
gtgaatcttgctgaagtaagtccgaaaacaaatgatgtggttcgtaaagaagatattgat
aagaaacaacaggcaccggcatcaacacaaacaacacaacaagcatctgcaaaagaagag
aaaaaatacaatcaatatcctacaaaaccagtgattcgtgaaaaaatgtcacgtagaaag
aaaacagctgccaaaaaattattagaggtatctaataatacagctatgttaacaacattt
aacgaagttgacatgacaaatgttatggaattgcgtaaacgtaagaaagaacaatttatg
aaagatcatgatggtactaaattaggatttatgtcattctttactaaagcttctgtagca
gctttgaaaaagtatccagaagttaatgcagaaatcgacggcgacgacatgattacgaaa
caatattatgatattggtgtagctgtttctacagatgatggattattagtaccatttgta
agagattgtgataaaaagaattttgcagaaatcgaagcagaaattgctaatttagcagtt
aaagcacgagagaaaaaacttggcttagatgatatggttaatggttcatttacgattaca
aatggcggtatttttggatcaatgatgagtacgccaattatcaatggtaatcaagctgca
atcttaggcatgcattcaattattacaagaccaattgcgattgatcaagatacaatcgaa
aatcgtccaatgatgtatattgcattaagctatgatcatagaattattgacggtaaagaa
gcagttggattcttaaaaacaattaaagaattaattgaaaacccagaagacttattatta
gaatcttaa

DBGET integrated database retrieval system