KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1771Help
Entry
SAS1771           CDS       T00183                                 

Definition
(GenBank) RNA pseudouridylate synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Brite
KEGG Orthology (KO) [BR:sas00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sas03009]
    SAS1771
Enzymes [BR:sas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SAS1771
Ribosome biogenesis [BR:sas03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    SAS1771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CAG43576
GeneDB: SAS1771
Position
1925546..1926367
Genome map
AA seq 273 aa AA seqDB search
MKFKIPENFNDLSLRDIFQQLKVPKKDLHHLNMSKDITINDKPARLMDKVHTGDDVFVPT
IDEKSNYVPSYRYAQIKYEDDDMAIVMKPKGVKTHPNDLKESNTLMNHVIYTIDSDYVEP
IHRLDQETVGLLIVAKNPLMKKILDRMLEDNDITRIYKANVKALLPLKPQTIDMPIGKDK
FHSNKRRVSPTGQRAITHILTSKMIKEAVCQLEIKLDTGRTHQIRVHLAEIGHPVIGDPL
YGDSTLRQLELESYKIEFVHPLTKEVISVSLDD
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttaaaataccagaaaactttaatgacttaagtttacgagatattttccaacaa
cttaaggtacctaaaaaagatttacatcatttaaatatgtctaaagatattactattaat
gataaacctgcgcgattaatggataaagtgcatactggcgacgatgtatttgttccaacc
atcgatgaaaaaagtaattatgttccaagttatcgttatgcacaaattaaatacgaagac
gatgatatggcaatcgtaatgaaacctaaaggtgttaagactcaccctaatgatttaaaa
gaaagcaatactttaatgaatcatgtgatttacactattgatagtgactatgtcgaacca
attcatcgactggaccaggaaacagtaggattattaattgttgctaaaaatcctttaatg
aaaaaaattcttgatcgcatgttagaagacaatgatattacgcggatatacaaagcaaat
gttaaggcacttttacctttgaaaccacaaacgattgatatgccaattggtaaagataaa
ttccattcgaataaacgacgtgtgtctcctactggacagcgtgcaattacacacatttta
acttcaaaaatgataaaagaagctgtgtgccaacttgaaatcaagttggatactggacgt
actcatcaaattcgtgtgcatttagctgaaattggtcaccctgttattggtgatccttta
tatggtgattcaacgttaagacaattagaacttgaaagttacaaaatagagtttgtgcat
cccttgactaaggaagtcatttccgtttctttggatgactaa

DBGET integrated database retrieval system