KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2060Help
Entry
SAS2060           CDS       T00183                                 

Definition
(GenBank) putative mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00051  Fructose and mannose metabolism
sas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SAS2060
Enzymes [BR:sas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SAS2060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N NAD_Gly3P_dh_N Sacchrp_dh_NADP UDPG_MGDP_dh_N Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: CAG43869
GeneDB: SAS2060
UniProt: Q6G7F3
Structure
PDB: 

Position
2215762..2216868
Genome map
AA seq 368 aa AA seqDB search
MKAVHFGAGNIGRGFIGYILADNNVKVTFADVNEEIINALAHDHQYDVILADESKTTTRV
NNVDAINSMQPSEALKQAILEADIITTAVGVNILPIIAKSFAPFLKEKTNHVNIVACENA
IMATDTLKKAVLDITGPLGNNIHFANSAVDRIVPLQKNENILDVMVEPFYEWVVEKDAWY
GPELNHIKYVDDLTPYIERKLLTVNTGHAYLAYAGKFAGKATVLDAVKDSSIEAGLRRVL
AETSQYITNEFDFTEAEQAGYVEKIIDRFNNSYLSDEVTRVGRGTLRKIGPKDRIIKPLT
YLYNKDLERTGLLNTAALLLKYDDTADQETVEKNNYIKEHGLKAFLSEYAKVDDGLADEI
IEAYNSLS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagttcactttggtgctggtaacataggtcgtggtttcattggttatattctt
gcagacaacaatgttaaagtaacatttgcagacgtcaatgaagaaatcattaatgcttta
gctcatgatcatcaatacgatgttattttagctgatgagtctaaaacaacgacgcgcgtg
aataatgttgatgcaattaattcaatgcaaccttctgaagcgttgaaacaagcaattcta
gaagctgatattattacaacagctgttggtgttaacatactacctattattgctaaatct
tttgcgcctttcttaaaagaaaaaacaaaccatgttaatattgttgcttgtgagaatgct
attatggcaactgatacattgaaaaaagcagtacttgatattactggccctcttggtaac
aatattcattttgctaactcagcagttgatagaattgtaccattacaaaagaatgaaaat
atattagacgttatggttgagccattttacgaatgggttgttgaaaaagatgcatggtat
ggcccagaactaaatcatattaaatatgttgatgatttaacaccatatattgagcgtaaa
ttattaactgtgaatacaggacatgcatatttagcgtatgctggtaaatttgcaggtaaa
gctaccgtattagacgctgtaaaagatagttcaattgaagctggcttacgccgtgtttta
gctgaaacaagtcaatatattactaatgaatttgattttactgaagcggaacaagctggt
tatgttgaaaaaataatagaccgtttcaacaattcttatttatctgatgaagtgacacgt
gtcggacgaggtacgttacgtaaaattggccctaaagatagaattataaaaccattaaca
tatctttataataaagatttagaacgcactggtttattaaatacagctgcattgttattg
aagtatgatgatacagcagaccaagaaactgttgagaaaaataattacattaaagaacac
ggtttaaaagcgtttttaagcgaatatgctaaagttgacgatggcttagccgatgaaata
attgaagcgtacaattcactttcataa

DBGET integrated database retrieval system