KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2354Help
Entry
SAS2354           CDS       T00183                                 

Definition
(GenBank) oligopeptide transporter putative ATPase domain
  KO
K10824  nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas02010  ABC transporters
Module
sas_M00440  Nickel transport system
Brite
KEGG Orthology (KO) [BR:sas00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SAS2354
Enzymes [BR:sas01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.24  nickel-transporting ATPase
     SAS2354
Transporters [BR:sas02000]
 ABC Transporters, Prokaryotic Type
  Peptide and nickel transporters
   Nickel transporter [MD:M00440] [OT]
    SAS2354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_22 AAA_16 AAA_29 AAA_21 Sigma54_activat AAA_24 DLIC MMR_HSR1 RsgA_GTPase AAA_33 NACHT SbcCD_C DUF87
Motif
Other DBs
NCBI-ProteinID: CAG44168
GeneDB: SAS2354
Position
complement(2520718..2521467)
Genome map
AA seq 249 aa AA seqDB search
MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
PDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKDVME
VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
ELIEKQLSF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattaaagatgttgaaaagtcatatcaaagcgcacatgtttttaagcgtcgt
cgaacacctatcgtgaaaggtgtgtcatttgagtgtccaatcggtgcgacgattgcgatt
atcggagaaagtggtagcggtaaatcgacattgagtcgtatgatattaggtattgagaaa
ccggataaaggttgtgtaaccttaaatgatcaaccgatgcataagaagaaagtgagacgt
catcaaattggtgctgtatttcaagattatacgtcatcattacatccatttcagactgtt
agagaaatcttatttgaagtgatgtgtcaatgtgatggacaacctaaagatgttatggaa
gttcaagcaattacattgttggaagaagtcggtctatctaaggcatacatggataaatat
cctaatatgttatcaggtggagaggcgcaacgtgttgcgattgcgcgtgcaatatgtatt
aaccctaaatatattttgtttgatgaagccattagttcactcgacatgtcaattcaaaca
caaatattagatttattgattcatttacgtgaaacgcgtcagttgagttatatttttatc
acacatgatattcaagctgccacgtatttatgtgatcaattaattatttttaaaaacgga
aaaatagaagaacaaattccgacaagcgcattgcataaaagtgacaatgcttatacaaga
gaattaatagaaaaacaactatcattctaa

DBGET integrated database retrieval system