KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2520Help
Entry
SAS2520           CDS       T00183                                 

Definition
(GenBank) putative ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00220  Arginine biosynthesis
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01130  Biosynthesis of antibiotics
sas01230  Biosynthesis of amino acids
Module
sas_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAS2520
Enzymes [BR:sas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SAS2520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: CAG44337
GeneDB: SAS2520
UniProt: Q6G640
Position
complement(2706099..2707109)
Genome map
AA seq 336 aa AA seqDB search
MTEIQKPYDLKGRSLLKESDFTKAEFEGLIDFAITLKEYKKNGIKHHYLSGKNIALLFEK
NSTRTRAAFTVASIDLGAHPEFLGKNDIQLGKKESVEDTAKVLGRMFDGIEFRGFSQQAV
EDLAKFSGVPVWNGLTDDWHPTQMLADFMTIKENFGYLEGINLTYVGDGRNNIAHSLMVA
GAMLGVNVRICTPKSLNPKEAYVDIAKEKASQYGGSVMITDNIAEAVENTDAIYTDVWVS
MGEESEFEQRINLLKDYQVNQQMFDLTGKDSTIFLHCLPAFHDTNTLYGQEIYEKYGLAE
MEVTDQIFRSEHSKVFDQAENRMHTIKAVMAATLGS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaattcaaaaaccgtatgatttaaaaggcagatcattattaaaagaaagtgat
tttaccaaagcagaattcgaaggacttattgattttgcaattacattaaaagagtataag
aaaaacggtattaagcatcactacttatctggaaaaaatattgcactactattcgaaaag
aattcgacgagaacgcgtgctgcgtttacagttgcgtctattgatttaggtgcgcatcca
gaatttttagggaaaaatgatattcaattaggcaaaaaagaatctgtagaggatactgcg
aaagtattaggtagaatgttcgatggtattgaattccgtggtttttcacaacaagctgtt
gaagatttagcgaagttctctggtgtgccggtgtggaatggattaacagacgattggcat
cctacacaaatgttagctgattttatgacaataaaagagaattttggatatctagaagga
ataaacttaacttacgttggagatggacgtaataatattgcgcattcattaatggtagca
ggtgctatgttaggtgttaatgtaagaatttgtacacctaaatcattaaatccaaaagag
gcatatgttgatattgcaaaagaaaaagcgagtcaatatggtggttcagtcatgattacg
gataatattgcagaagcagttgaaaatacagatgctatatatacagatgtttgggtatcg
atgggtgaagaaagtgaatttgaacaacgtattaatttattaaaagactatcaagtgaat
caacagatgtttgatttaacaggtaaagattcaacgatattcttacattgtttaccagca
ttccatgatacaaatacactttatggacaagaaatttatgaaaaatatggattagctgaa
atggaagttacagaccaaatctttagaagtgaacattcaaaagtgtttgatcaagctgaa
aatagaatgcatacaattaaggcagtaatggcagcaacattggggagttaa

DBGET integrated database retrieval system