KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2520
Entry
SAS2520           CDS       T00183                                 

Definition
(GenBank) putative ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00220  Arginine biosynthesis
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01230  Biosynthesis of amino acids
Module
sas_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SAS2520
Enzymes [BR:sas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SAS2520
SSDB
Motif
Pfam: OTCace OTCace_N
Other DBs
NCBI-ProteinID: CAG44337
GeneDB: SAS2520
UniProt: Q6G640
Position
complement(2706099..2707109)
AA seq 336 aa
MTEIQKPYDLKGRSLLKESDFTKAEFEGLIDFAITLKEYKKNGIKHHYLSGKNIALLFEK
NSTRTRAAFTVASIDLGAHPEFLGKNDIQLGKKESVEDTAKVLGRMFDGIEFRGFSQQAV
EDLAKFSGVPVWNGLTDDWHPTQMLADFMTIKENFGYLEGINLTYVGDGRNNIAHSLMVA
GAMLGVNVRICTPKSLNPKEAYVDIAKEKASQYGGSVMITDNIAEAVENTDAIYTDVWVS
MGEESEFEQRINLLKDYQVNQQMFDLTGKDSTIFLHCLPAFHDTNTLYGQEIYEKYGLAE
MEVTDQIFRSEHSKVFDQAENRMHTIKAVMAATLGS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atgacagaaattcaaaaaccgtatgatttaaaaggcagatcattattaaaagaaagtgat
tttaccaaagcagaattcgaaggacttattgattttgcaattacattaaaagagtataag
aaaaacggtattaagcatcactacttatctggaaaaaatattgcactactattcgaaaag
aattcgacgagaacgcgtgctgcgtttacagttgcgtctattgatttaggtgcgcatcca
gaatttttagggaaaaatgatattcaattaggcaaaaaagaatctgtagaggatactgcg
aaagtattaggtagaatgttcgatggtattgaattccgtggtttttcacaacaagctgtt
gaagatttagcgaagttctctggtgtgccggtgtggaatggattaacagacgattggcat
cctacacaaatgttagctgattttatgacaataaaagagaattttggatatctagaagga
ataaacttaacttacgttggagatggacgtaataatattgcgcattcattaatggtagca
ggtgctatgttaggtgttaatgtaagaatttgtacacctaaatcattaaatccaaaagag
gcatatgttgatattgcaaaagaaaaagcgagtcaatatggtggttcagtcatgattacg
gataatattgcagaagcagttgaaaatacagatgctatatatacagatgtttgggtatcg
atgggtgaagaaagtgaatttgaacaacgtattaatttattaaaagactatcaagtgaat
caacagatgtttgatttaacaggtaaagattcaacgatattcttacattgtttaccagca
ttccatgatacaaatacactttatggacaagaaatttatgaaaaatatggattagctgaa
atggaagttacagaccaaatctttagaagtgaacattcaaaagtgtttgatcaagctgaa
aatagaatgcatacaattaaggcagtaatggcagcaacattggggagttaa

DBGET integrated database retrieval system