KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2563Help
Entry
SAS2563           CDS       T00183                                 

Definition
(GenBank) putative histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00340  Histidine metabolism
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SAS2563
Enzymes [BR:sas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SAS2563
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh HALZ DUF4435 MbeB_N DUF2064 DUF883 FadA
Motif
Other DBs
NCBI-ProteinID: CAG44380
GeneDB: SAS2563
UniProt: Q6G5Z7
Position
complement(2763842..2765098)
Genome map
AA seq 418 aa AA seqDB search
MPMLNAQQFLNQFSLEAPLDESLYPIIRDICQEVKVHGDKALKMYNLTFDHTKTDHLEIS
HEQIKAAFDTLDEKTKQALQQSYERIKAYQESIKQTNQQLEESVECYEIYHPLESVGIYV
PGGKASYPSTVLMTATLAQVAGVENIVVVTPPQPNGVSQEVLAACYITQVNQVFQVGGAQ
SIAALTYGTETIPKVDKIVGPGNQFVAYAKKYLFGQVGIDQIAGPTEIALIIDDTADLDA
IVYDVFAQAEHDELARTYVIGEDAQVLKDLESRIAKALPNVDRYDIVSKSIANQHYLIHA
SNFDEACHVMNTIAPEHASIQTVNPQPYIEKVKYVGALFIGHYSPEVIGDYVAGPSHVLP
TNRTARFTNGLSVNDFLTRNTVIHLSKDTFEQIADSAQHIAHVEALYNHQQSILIRQS
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
ttgccaatgcttaatgcacaacaatttttaaatcaattttcattagaagcaccattagat
gagtcattgtatccaattattcgcgatatttgtcaggaagttaaagttcatggagataag
gctttgaaaatgtataatctaacattcgatcatacgaaaacagatcatttagaaattagt
catgaacaaattaaagcagcatttgacacattagatgaaaaaacaaaacaagcattacaa
caaagttatgaaagaattaaagcatatcaagaaagtattaagcagacgaatcaacagtta
gaagaatcagtggagtgttatgaaatataccatccactagaaagtgtgggtatttatgtg
cctggtggcaaagcaagttatccatcaacggttctaatgacagcgactttagcacaagta
gcgggtgtagaaaatattgttgttgtgacaccacctcaacctaacggagtatcccaagag
gtattagctgcatgttatattacgcaagttaatcaagtgtttcaagttggtggtgctcaa
agtattgctgcattgacttatggaacagaaacgatacctaaagttgataagattgtaggt
ccaggtaaccaatttgttgcatatgccaaaaaatatttatttggacaggtaggtattgat
caaattgcaggaccaacagaaatagcactgattattgacgacaccgcagatttagatgcc
atcgtatatgatgtatttgcgcaagcagaacatgatgaattagcacgtacatatgtcatt
ggtgaagatgcgcaagtccttaaagatttagaatcacgtattgctaaagcattgcctaat
gtggacagatacgacattgtttctaaaagtatcgctaatcaacactaccttatccatgct
agtaattttgatgaagcatgccatgtcatgaatacaatcgcgcctgaacatgcgtcgatt
caaacagtaaatcctcaaccatatattgaaaaagtgaaatatgtgggtgcattgtttatt
ggacattattcgccagaggtcataggagattacgttgcaggtccaagtcatgtattacct
acaaatagaacagctagatttaccaatgggttatcggtcaatgatttcttaacacggaac
acggtcatccatttatcaaaagatacgtttgaacaaattgctgattcagcacaacatatt
gctcatgttgaagcattatacaatcaccagcagtctattttaatacgtcagtcttag

DBGET integrated database retrieval system