KEGG   Salmo salar (Atlantic salmon): 100136416Help
Entry
100136416         CDS       T04363                                 

Gene name
cpt1
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00071  Fatty acid degradation
sasa01212  Fatty acid metabolism
sasa03320  PPAR signaling pathway
sasa04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100136416 (cpt1)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100136416 (cpt1)
   03320 PPAR signaling pathway
    100136416 (cpt1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sasa03029]
    100136416 (cpt1)
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     100136416 (cpt1)
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100136416 (cpt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 100136416
NCBI-ProteinID: XP_014040095
UniProt: A0A1S3QJ90
Position
Un
AA seq 774 aa AA seqDB search
MAEAHQAVAFQFTVSPDGIDLQLSHEALRQIYLSGLHSWKKKFIRFKNGVMTGVYPGSPT
GLMLVVGLYMGRAKYVQADPSLALFTKVGAHLPVSRYMSFENQQVVGGVLVGTGLWVAIF
FTMRTSLKWLLSWHGWMYARHGTVPWRTRIWLVLVKIFSGRRNPQLYSFQTSLPQLPLPS
VKDTINRYLESARPLMDDEQYLRMEGLAKDFEKGLGPKLQWYLKLKSWWATNYVSDWWEE
YIYLRGRGPIMVNSNYYAMDFLYVFPTSLQAARAGNAIHAIMLYRRMLDRAQIKPLFALD
KRVPLCSAQWERLFNTSRLPGLERDTIQHMQDSRHIVVYHRGRYFKVPMFYDGQVLSPRA
VEQQMERILADPSEPQPGEERLAALTAGDRVPWAEAREAYLRQGRNQQALDTVEKAAFFV
TLDDTEQRYKAEDPVRSLDSYAKSLLHGKCYDRWFDKSFNLIVFRNGTMGLNAEHSWADA
PIIGHLWEHVLSMDPVKLGYTEEGHCKGNPHPSLPGPQRLQWNIPAECQTAIASSLMVAK
ALADDVDSHIIPFNCFGKGLIKKCRTSPDAFIQIALQLAHFRDKGRFCLTYEASMTRMFR
EGRTETVRSCTVETCAFVRSMVEDNPRELRLKLLKEAATKHQQLYRLAMTGGGIDRHLFC
LYVVSKYLGEDSAFLKEVLSEPWRLSTSQTPLQQVELFDLARHPEYVSSGGGFGPVADDG
YGVSYIILGENLINFHISSKHSSPETDSHRFGNHIKQAMLDILALFQLDANALV
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaggctgtggcgttccagttcaccgtctctccagacggcattgat
ctgcagttgagccacgaggccctgagacaaatctacctgtctggcctgcattcctggaag
aaaaagtttatccgcttcaagaatggggtgatgaccggggtgtaccctggcagtcccacc
ggcctgatgttagtggtggggctgtacatggggagggcaaagtacgtccaagctgaccct
tccttggcactgttcaccaaagtgggtgctcacctgcctgttagtcgctacatgtccttt
gagaaccagcaggtggttggcggtgtactagttggcacagggctctgggtggccattttt
ttcaccatgcgaacttcactcaagtggctgctctcctggcatggatggatgtatgcccgt
cacggcactgtgccatggaggacacgcatctggctggtactggtgaaaatcttctccgga
aggcggaatccccagttgtacagcttccagacatcgttaccacagctccctctgccttcg
gtgaaagacaccatcaatagataccttgaatctgcccgtccgctcatggacgacgaacag
tacttgaggatggagggccttgccaaggattttgagaaaggcctgggtcctaaacttcag
tggtacctgaaactcaaatcctggtgggctacaaactatgtcagtgactggtgggaggag
tacatctacctaagaggccgtggaccaatcatggtcaacagcaactactatgcaatggac
ttcctgtatgtgtttcccaccagtctgcaggccgctcgggcaggcaatgctatccatgcc
atcatgctgtacaggagaatgctggaccgagcgcagatcaaaccgctctttgcactggat
aaaagagttcctctttgctccgcccaatgggagcgcttgttcaatacgtcccgcctccca
ggcctggaacgggacaccatccagcatatgcaggacagcaggcacatcgtggtgtaccac
cgggggcgctacttcaaggtgcccatgttctacgacggtcaggtgctgtcgcccagggcc
gtagagcagcagatggagcgtatcctggctgacccctctgaaccccagccgggggaggag
cgcctggccgccctcactgctggggacagggtgccctgggcggaagcccgcgaggcctac
ctgagacagggcaggaaccagcaggccctggacactgtggagaaggctgccttctttgtg
accctggacgacacagagcagcgttacaaggctgaggatcctgtccgatccctggacagc
tatgccaagtccctgctgcatggcaaatgttacgacaggtggtttgataagtccttcaac
ctcatcgtgttcaggaacgggaccatgggtctgaacgcggagcacagctgggcagatgcc
cccatcatagggcacctctgggagcatgtgctgtcgatggaccctgtgaagctgggttac
acagaggaaggccactgcaaaggaaaccctcacccctccctcccaggccctcagaggctg
cagtggaacatcccagctgagtgtcagacggccatcgccagctctctgatggtggccaag
gccctggcagacgacgtcgactcccacatcatccccttcaactgctttgggaagggcctg
atcaaaaagtgtcgtaccagccccgatgccttcatccagatcgccctgcagctggctcac
ttcagggacaaggggaggttctgtctaacgtacgaggcgtccatgacacgcatgttccga
gagggtcgcacagagacggtgcgttcctgtaccgtggagacctgtgccttcgtccgctcc
atggtggaagacaacccgagagagctgcgactgaaactgttgaaggaagctgcgacgaaa
caccagcagctctaccggctggccatgactggaggaggcatcgaccgccacctcttctgt
ctctacgtggtctccaagtacctgggggaggactcggccttcctcaaagaggtgctgtcg
gagccctggaggctgtccaccagtcagactcccctccagcaggtggagttgtttgacctg
gccagacacccggagtacgtgtccagcgggggaggctttggtccggtggcagatgatgga
tatggtgtgtcctacatcatcttgggagaaaacctcattaacttccacatctccagcaag
cactcgagtcctgagacggactctcatcgttttggaaaccacatcaaacaggccatgctc
gacatcctggccttatttcagctcgatgcaaatgccttggtgtga

DBGET integrated database retrieval system