KEGG   Salmo salar (Atlantic salmon): 100194972Help
Entry
100194972         CDS       T04363                                 

Gene name
mgll
Definition
(RefSeq) monoglyceride lipase
  KO
K01054  acylglycerol lipase [EC:3.1.1.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00561  Glycerolipid metabolism
sasa01100  Metabolic pathways
Module
sasa_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:sasa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    100194972 (mgll)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100194972 (mgll)
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S33
   100194972 (mgll)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Esterase Lipase_3 DLH Peptidase_S9 PGAP1 Abhydrolase_2 LIDHydrolase DUF2048 DUF1350 Thioesterase PAF-AH_p_II
Motif
Other DBs
NCBI-GeneID: 100194972
NCBI-ProteinID: NP_001133473
UniProt: B5X1X7
Position
ssa15
AA seq 302 aa AA seqDB search
MPEPEDPRRTPQGVSYADLKHFVNADGQHLFCRYWEPDAPPRALVFVAHGAGEHCGPYDE
IGRTLKEQSMLVFAHDHVGHGQSEGDRMNIKDFQVFVRDSLQHIDLMKGRHPGLPIFIIG
HSMGGAISILTACARPNDFAGVALIAPMVRVNPESATPFKVFLAKVANHIVPSLSLGFIK
SKWISRDQTQVEAYDTDELNHHGGMRVSFAMQLIGASERIEREIPAITWPFLLLHGDVDK
LCDIGGSQMMFDKAPSADKKIKVYDGAYHALHHELPETAASVLKEVTGWISERLPASPSQ
GS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaccagaagatccgcgtcggactccgcaaggtgtctcctacgccgacctgaag
cacttcgtcaatgccgacggacagcacttgttctgccgctactgggagccggatgcccca
ccaagggctctggtgttcgtggcacatggggcaggagagcattgtgggccgtatgatgag
atcggccggaccctgaaggagcagtccatgcttgtctttgcgcacgaccacgttggccat
ggccagagtgaaggagaccggatgaatattaaggacttccaggtgtttgtcagagactcc
ctccagcacattgatctgatgaagggccgacaccccggcctgcctatcttcatcatcgga
cactctatgggtggagccatctcaattctgacggcatgtgcacgaccgaacgactttgcc
ggcgtggctctgatcgctcctatggtcagggtgaacccagagtctgccacgcccttcaag
gttttcttggctaaagtcgcaaatcacattgtgcccagtctctctctgggcttcattaag
tctaaatggatttcacgggaccaaacacaggttgaagcatatgacactgatgagttgaac
catcatggtggaatgcgggtgtcatttgccatgcagctgataggcgcgtcggagcggatc
gagagagaaatccccgccatcacctggcccttcctgcttctccatggcgacgtcgacaag
ctgtgtgacatcggagggtcccagatgatgtttgacaaggccccgagcgcggacaagaag
atcaaggtgtatgacggagcataccatgccctgcaccatgaactcccagagactgcggcg
tcagtgctcaaggaagtcaccggctggatctccgagcgtctccctgcgtctccttctcag
gggtcttag

DBGET integrated database retrieval system