KEGG   Salmo salar (Atlantic salmon): 100195231Help
Entry
100195231         CDS       T04363                                 

Gene name
galc, GALCERase
Definition
(RefSeq) galactosylceramidase
  KO
K01202  galactosylceramidase [EC:3.2.1.46]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00600  Sphingolipid metabolism
sasa01100  Metabolic pathways
sasa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    100195231 (galc)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100195231 (galc)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100195231 (galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_59 Glyco_hydro_59M
Motif
Other DBs
NCBI-GeneID: 100195231
NCBI-ProteinID: NP_001133732
UniProt: B5X3C1 A0A1S2X0F5
Position
ssa01
AA seq 666 aa AA seqDB search
MIYKLYFAIALCFSLCFDLCIAESYVLDDKVGLGRTFDGIGGLSGGGATSRLLVNYAEPY
RSQILDYLFKPNFGASLHILKVEIGGDAQTTDGTEPSHMHYENDENFFRGYEWWLMREAK
KRNPNITLIGLPWAFPGWVGHGKNWPYDFPDITASYVVSWILGAKHYHDLNIDYVGIWNE
RNFDSKYIKLLRYTLDKSGLERVRIIASDNLWQPITYSLCVDQELADAVDVIGAHYPGTT
TVIEALKTQKKLWSSEDYSTFNDEVGGGCWARILNQNYVNGLMTATISWNLVASYYEDLP
FGRDGLMTAEEPWTGNYVVESPIWITAHTTQFSQPGWTYLQTVGHLVHGGSYVALTDSNG
NLTVVIETMTHDHSVCIRPPLLPFNVTAQNVTFQLKGSFALIKELQVWQSRFDFKTKKPF
FFKKLSPLKISDGSFTLSLDVDEVYTLTTISTGLKGTYPDPPTSGPFPKVYFDDFNVANP
SFSEAPDFADQTGVFEYYINLTDPGPHVFTLRQVVTQMPVTWATDADQTISVIGDYKWQN
LTVTCDVFMETVKTGGVFIAARVDKGGQSVRSAKGVFFWVFADGSYKVTNDLVGKTVLAE
GLSGTRAYGWHTLTLTVEGQYATGLLNGYPLWKDAVVLGPKNGWAAIGTHSFELAQFDNF
AVEAKL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgatttataaattatattttgctatcgccttgtgttttagtttgtgttttgatctctgt
attgccgagagctacgttttggatgataaagttggattaggaagaacgtttgacggcatt
ggtggtttgagtggtggaggggcaacatctcgtctacttgtcaattatgcagaaccctac
cgcagccagatattggactatctcttcaagccaaactttggggcttctctacacatcctg
aaagtggagattggaggtgatgcccaaaccacagatggaacggaaccctctcacatgcac
tatgaaaatgatgagaacttcttccgagggtatgaatggtggctgatgagagaagccaag
aagaggaaccccaacatcactctcataggcttgccatgggcctttccgggttgggttgga
catgggaagaactggccgtatgacttccctgatattaccgcatcctacgtggtgtcgtgg
attttaggagccaaacactaccatgacctgaatattgattatgtcgggatttggaatgaa
cggaacttcgacagcaagtacatcaagctgctgcggtacactctggataagagtggtttg
gagagggtcagaatcatagccagtgataacctttggcagcccataacctattcattgtgt
gtcgatcaagagctggccgacgcagtagacgtgataggggcccactacccaggcaccacc
acagtgatagaggccctgaagacccagaagaagctatggtcgtctgaagactacagcacc
tttaacgacgaggtgggaggaggctgctgggcccggatcctcaaccagaactatgtcaac
ggactcatgactgccaccatatcctggaacctggtagccagttactatgaggaccttccc
tttgggagagatggcctaatgaccgcagaggagccgtggactgggaactatgtggtggaa
tcacccatctggataactgcccacaccacccagtttagccagccaggatggacctatctg
caaaccgttgggcatctggtacacgggggaagttatgttgccctgaccgacagtaacgga
aacctcactgttgtaatagaaaccatgactcatgatcattctgtgtgcatcagacctcca
ctcctgcccttcaatgtcacagcccagaatgtaacattccaactcaagggatcttttgct
ttgatcaaggaactacaggtgtggcagtcaaggtttgacttcaagactaaaaagccgttc
ttcttcaagaaattgagccccttaaagatttctgatggttcgttcaccttgagcctggat
gttgatgaggtttacactttaaccaccatatccactggactgaaagggacttaccctgat
ccacccacctctggcccattccctaaagtttactttgatgactttaatgttgccaaccct
tccttctctgaggccccagactttgctgaccagacgggggtgtttgagtattacattaac
ctgacggaccctggtcctcatgtcttcactttgcgccaggtggtcacacagatgcctgtt
acctgggcaacagatgctgaccagaccatcagcgtcattggagactataaatggcagaac
ctgacagtgacgtgtgatgtcttcatggagacggtgaagactgggggagtgttcatcgca
gccagagtggacaaaggagggcagtctgtccgtagcgccaagggagtcttcttctgggtg
ttcgcagatggctcctacaaagtcaccaatgacctagttggcaagactgtactggcagag
ggtctgtctggaacgagagcgtatggctggcacacgttaaccctcacagtcgaggggcag
tatgccacagggttgctgaatggatatccactatggaaggatgctgtggtattgggacca
aagaatggctgggctgccataggaacacactcatttgaacttgcacagtttgacaacttt
gctgtggaagcaaaattataa

DBGET integrated database retrieval system