KEGG   Salmo salar (Atlantic salmon): 100195326Help
Entry
100195326         CDS       T04363                                 

Gene name
abhd6
Definition
(RefSeq) Abhydrolase domain-containing protein 6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    100195326 (abhd6)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100195326 (abhd6)
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S33
   100195326 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase FSH1 Esterase Abhydrolase_2
Motif
Other DBs
NCBI-GeneID: 100195326
NCBI-ProteinID: NP_001133827
UniProt: B5X3T9
Position
ssa22
AA seq 346 aa AA seqDB search
MDVDVVNMFVLAGGTLVIPILAFFASFYMWPAAIIHVYNWYWRRRLGLQVVYSENRGYRF
CYSHRGKPGPGRPSILMLHGFSANKDMWLPVAKFLPKHQHLLCIDMPGHEGTSRTDARDY
SIEGQVKRIRQFVESVRLTKRPFHLVGTSMGGNVAGVYAARYPNDLCSVTLICPAGLPNE
SPFVERLRELEKDRELSGSLDPQGIPLIPSTPEEMEDMLKLCSFVRFKIPQQILQGLVDV
RVPNNDFYRELFMEIVGEKSRHSLHENMHLITVPTQVIWGKHDQVVDVSGSSMLKEAVSG
CQVELLDNCGHSVVMERPRKTAQLIMDFINNQHNSGSGSNNSKKLS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagacgtggtgaacatgtttgtcctggcgggaggaactctagtcatccctatc
ctggccttctttgcctcattctacatgtggcctgcagctattatccatgtttataactgg
tactggcgtcgccggctgggcctgcaggttgtctactctgagaacagaggttaccggttc
tgttactcccacagagggaagcctggtccaggccgcccctctattctcatgctccacggc
ttttctgctaacaaggacatgtggctgcctgtggctaagtttctgcccaagcaccagcac
ctgctgtgcattgacatgcctggacacgagggcaccagccgcaccgatgccagagactat
tccatagagggacaggtcaagaggatacgacagttcgtggagagtgtccgtctgaccaag
aggcccttccacctagtgggtacatccatgggaggaaacgttgccggagtgtacgctgcc
cgctaccccaacgatctttgcagtgtcaccctcatctgtcccgcaggtcttccgaacgag
agtccgtttgtggagcggctgagggagctggagaaggaccgtgaactgagtgggagcctg
gatccccagggcatccctctgatcccctctaccccagaggagatggaggatatgctcaaa
ctctgctctttcgtacgcttcaagatccctcaacagattcttcagggattggtggatgtt
cgagttccaaacaacgacttctacagagagttgttcatggagatcgtaggagagaagtcc
agacactctttacatgagaacatgcatctgatcacagtcccaacacaggtcatctggggg
aagcatgaccaggtggtggacgtgtctggatcatctatgctgaaggaggccgtctctggc
tgccaggtggagttgctggacaactgtggtcactctgtggtgatggagcgacctcgcaag
acagctcagctcatcatggactttatcaataaccaacacaactctggctctggctctaac
aacagcaagaaactctcctga

DBGET integrated database retrieval system