KEGG   Salmo salar (Atlantic salmon): 100195485Help
Entry
100195485         CDS       T04363                                 

Gene name
abhd12, abd12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    100195485 (abhd12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100195485 (abhd12)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100195485 (abhd12)
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100195485 (abhd12)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100195485 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_2 Peptidase_S9 Thioesterase Abhydrolase_3 Lipase_3
Motif
Other DBs
NCBI-GeneID: 100195485
NCBI-ProteinID: NP_001133986
UniProt: B5X4N4
Position
ssa01
AA seq 372 aa AA seqDB search
MQRTGGSVSKHLRMRKRTGDHDSEEQKTARKKTWASSSAQPRPCPRLLWWFKRGLLAVCV
IYVSVPFMMAPFPDIIKHLVYSHRVRVPFFIDHSQPADLSLNHTMNMYLTSEHGISLGVW
HTVPESQWKEAQGKDLEWYQDSLGAGNPIFIYLHGNGGTRAASHRVGVIHLLSAMDYHVL
ALDYRGFGDSTGEPTEVGLTTDTLYLYQWVKARSGSSLVVLWGHSLGTGVATNTAVKLME
HGIVVDGVIIEGAFTNIRQKGAHDLFGWFYWKFPGFEYFFLDTRAENNIIFPNDENLKRM
RSPLLILHAEDDHIVPIHMAQQLYEIAQSAQNSENRVKMVPFARSLGYLHNGLYKDPHLP
NIIREFVHSLPP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcagaggactggtggctcggttagtaaacatctcaggatgaggaagaggaccggtgac
catgattccgaggagcagaagactgcgagaaaaaaaacttgggcgtcatcgagtgcgcag
ccgagaccttgcccccgtttgttgtggtggttcaaaagaggtctcctggccgtatgtgtc
atttatgtttctgtgcctttcatgatggcaccgtttcctgacatcataaagcacctggtt
tattctcacagagtcagggtcccattcttcatcgaccacagccagccagccgacctgtct
cttaaccacacaatgaacatgtaccttacatccgaacacgggatctcattgggagtatgg
cacacagtccctgaaagtcagtggaaagaggcacagggaaaggacttggaatggtaccaa
gattctttgggagctggaaatccgatcttcatttatcttcatggcaatggaggcacaagg
gcagcaagtcaccgtgtgggagtaatacatctgctgagtgcaatggattaccatgttttg
gctttggactacagaggtttcggggactccaccggagagcccactgaagttggtctaacc
actgacaccctctacttgtaccagtgggtaaaagcccgcagtgggagcagtctggtggta
ttatggggacactcccttggcactggagtggccactaatactgcagtcaaactaatggaa
catgggattgttgttgatggtgtgatcattgagggagcattcaccaacattcgacagaag
ggtgctcatgatctgtttggctggttttattggaagttcccaggttttgagtactttttc
ctggacacaagggcagaaaacaatataatcttccctaatgatgaaaacttgaagaggatg
aggagtcctcttctgatacttcatgcagaggatgaccacatagtgcctatccacatggct
cagcagctgtatgaaattgcacagagcgcccaaaactcagagaatcgagttaagatggta
ccgttcgccagatcccttgggtaccttcacaatggattgtacaaagaccctcacctgccc
aacattattagggaatttgtacattcattgcccccctaa

DBGET integrated database retrieval system