KEGG   Salmo salar (Atlantic salmon): 100195562Help
Entry
100195562         CDS       T04363                                 

Gene name
ctso, cato
Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04142  Lysosome
sasa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100195562 (ctso)
  09143 Cell growth and death
   04210 Apoptosis
    100195562 (ctso)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    100195562 (ctso)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     100195562 (ctso)
Peptidases [BR:sasa01002]
 Cysteine Peptidases
  Family C1: papain family
   100195562 (ctso)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Inhibitor_I29
Motif
Other DBs
NCBI-GeneID: 100195562
NCBI-ProteinID: NP_001134063
UniProt: B5X5H2
Position
ssa05
AA seq 341 aa AA seqDB search
MTGVTLFLMFLLNLGILTFPDVARCSGVWKTIRKSNCSAGTDVDFESFREQFHRNYKLHS
DCYHRRRSYFKNSIKRHAYLNSLSTDKDSAKYGINQFSDLSIHEFRELYLTATAETVPPY
SGLKTEGLPAKFDWRVKAAVGSVQNQQACGGCWAFSVVGAIESVYAKSGQPFKQLSVQQV
IDCSYKNQGCNGGSITRALSWLKQTRVKLVKQSEYPYKAETGICHLFSQSHDGVLVKDFA
AHDYSGHEEAMMGRLVEWGPLAVTVDAISWQDYLGGIMQHHCSCHHANHAVLVTGYDTTG
DVPYWIVQNSWGTSWGNEGYVYIKMGGNVCGIADSVTAVFL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtgttacattgtttctcatgttcctcctaaacttaggcatacttacttttccc
gatgttgctcgttgtagtggcgtttggaaaactatcaggaagtccaactgctctgcaggc
actgatgttgatttcgagtcgtttagggaacaatttcatcggaattataaactccacagc
gattgttatcatcggcgcagatcttattttaagaattccatcaaaaggcatgcatacctg
aactcattgtcaacagacaaagactcagcaaaatatggcattaaccagttctcggattta
tcaatacatgaattcagagaactgtatttgactgccacagctgaaacagtccctccctac
tcaggactgaagacagagggactgcctgccaagtttgactggagggtcaaggctgcagtc
ggatcagtacagaatcaacaagcatgtggaggttgctgggcgttcagtgttgtgggcgcc
atagagtcagtctatgccaaatcaggccagccatttaaacagctcagtgtgcaacaagtc
attgactgttcctacaagaaccagggctgcaatggaggctccattaccagggccttgagc
tggctgaaacagactagggttaagttggtgaaacagtcagaatacccatataaggccgag
actggaatttgccatttattttctcagtcacatgatggtgttttggtgaaggactttgct
gcccatgattacagtgggcatgaggaggctatgatgggcaggttggtggagtggggaccc
ttggctgtgactgtggatgccatcagttggcaggactatctgggtggcatcatgcagcac
cactgctcctgccaccatgccaaccatgctgtgctggtcactggttacgacaccacaggt
gacgtgccatactggatagtacaaaactcatggggaacgtcatggggtaacgaaggttat
gtttatattaaaatgggaggcaatgtttgtggtattgccgactctgtgactgctgtcttc
ctgtga

DBGET integrated database retrieval system