KEGG   Salmo salar (Atlantic salmon): 100195702Help
Entry
100195702         CDS       T04363                                 

Gene name
atd4b
Definition
(RefSeq) atad4-B
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB OrthologParalogGFIT
Motif
Pfam: ATAD4
Motif
Other DBs
NCBI-GeneID: 100195702
NCBI-ProteinID: NP_001134203
UniProt: B3TDD4
Position
ssa19
AA seq 109 aa AA seqDB search
MADPSWWKLTFSPKNSEANVLYEIPQEYGNNAGNKEHHNSPQLPTDPMDNQFSARLEKIV
DKSATKGRHVKVSHSGRFKEKKKIRATLAENPMLFSEHSLSDENHRAEK
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggctgaccctagctggtggaagctgaccttctcacctaagaattctgaggcaaatgtt
ctgtacgagatcccccaagagtatggtaataacgctgggaataaggagcatcacaacagc
cctcagctccccacagacccaatggacaaccaattcagtgccagactggagaagatagtg
gataagtcggccactaaaggtcgccatgttaaggtgtcccactctggtcgcttcaaggag
aagaagaagatccgtgccacactggctgagaaccctatgctgttctctgaacacagtctc
agtgatgagaaccacagggcagagaaatag

DBGET integrated database retrieval system