KEGG   Salmo salar (Atlantic salmon): 100195992Help
Entry
100195992         CDS       T04363                                 

Gene name
adhx, ADH3
Definition
(RefSeq) Alcohol dehydrogenase class-3
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00071  Fatty acid degradation
sasa00350  Tyrosine metabolism
sasa00830  Retinol metabolism
sasa00980  Metabolism of xenobiotics by cytochrome P450
sasa00982  Drug metabolism - cytochrome P450
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100195992 (adhx)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    100195992 (adhx)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100195992 (adhx)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100195992 (adhx)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100195992 (adhx)
   00982 Drug metabolism - cytochrome P450
    100195992 (adhx)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100195992 (adhx)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     100195992 (adhx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C 2-Hacid_dh_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 100195992
NCBI-ProteinID: NP_001134493
UniProt: B5XA77
Position
ssa05
AA seq 376 aa AA seqDB search
MEAAGKVIKCKAAVAWEAGKPLSIEEVEVAPPKANEVRIKVFATGVCHTDAFTLSGSDPE
GLFPVILGHEGAGTVESVGEGVTKFKPGDTVIPLYVPQCGECKFCKNPKTNLCGKIRITQ
GRGLMPDSTSRFTCKGKQLFHFMGTSTFSEYTVVADISVAKVDEKAPLDKVCLLGCGIST
GYGAALNTAKVEPGSTCAIFGLGAIGLAVIMGCKAAGATRIIGVDINPDKFDKGKEFGAT
ELVNPKDHSKPIQEVLVEMTDGGVDYSFECIGNVAIMRAALEACHKGWGESIIIGVAGAG
KEISTRPFQLVTGRVWRGTAFGGWKSVDSVPKLVTDYMNKKLKVDEFVTHTLPLDQINEA
FDLMHAGKSIRTVLKF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaggcagctgggaaggtgatcaagtgcaaggcagcagtagcttgggaggctgggaaa
cctctgtccattgaggaggtggaggtggccccaccgaaggccaacgaagtgcgcatcaag
gtctttgcgacaggggtttgtcacacagatgccttcaccttgagtggcagtgaccccgag
ggacttttccctgtcatcctgggtcatgagggcgccgggacagtcgaaagcgtgggagag
ggagtcaccaagttcaaaccaggtgacaccgtcatcccattgtatgtgccacagtgtggt
gagtgcaaattctgcaaaaaccccaagaccaacctctgcgggaagatcagaataacccag
ggccggggtctgatgcctgacagcacctcgcggttcacctgcaagggcaagcagctgttc
cacttcatggggaccagcaccttctctgaatacacagtggtggctgacatctcggtggcc
aaggtggatgagaaggcccccctggacaaggtgtgcttgctgggctgcggcatctccacg
ggctacggagctgccctcaacactgccaaggttgagcctggctccacctgtgccattttc
ggcctgggcgccatcggccttgctgtcatcatgggctgcaaggctgccggggcgaccagg
ataatcggcgtggacataaacccagacaagtttgacaagggcaaagagtttggggccacc
gagttggtgaaccccaaggaccacagcaagcccatccaggaggtgctggtggagatgacc
gacggtggggtggactactcctttgaatgcatcggcaacgtggctattatgagggcagct
ctggaggcgtgccacaaaggctggggcgagagcatcatcatcggggtggcaggcgcggga
aaggagatctccacacgtccgttccagctggttaccggccgtgtgtggaggggcacagca
tttggaggctggaagagtgtggatagcgtccccaaactagtgactgactacatgaacaag
aagctgaaggtggatgagtttgtgacccacaccttgccccttgaccagatcaatgaggca
tttgacctcatgcatgctggaaagagcatccgtaccgtcttgaagttctga

DBGET integrated database retrieval system