KEGG   Salmo salar (Atlantic salmon): 100196067Help
Entry
100196067         CDS       T04363                                 

Gene name
emc4, tmem85, tmm85
Definition
(RefSeq) ER membrane protein complex subunit 4
  KO
K23565  ER membrane protein complex subunit 4
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    100196067 (emc4)
Membrane trafficking [BR:sasa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Others
   ER membrane protein complex
    100196067 (emc4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1077
Motif
Other DBs
NCBI-GeneID: 100196067
NCBI-ProteinID: NP_001134568
UniProt: B5XB24 A0A1S2X286
Position
ssa07
AA seq 188 aa AA seqDB search
MASPGGQGGGAVSTRGAGARRMKWALELSLGNARGRGDRQSNQGDVMYPIGYSDKPVPDT
SIQETDKNLVEKRCWDVALGPLKQIPMNLFIMYMSGNTISIFPIMMVCMMAWRPIQALMS
MSATFKLLENSNQQWLQGLVYSVGNLLGSALAIYKCQSMGLLPTHSSDWLAFIEPPQRME
IMGGGMVL
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctccagggggacagggaggaggggcagtgtctacaagaggagcaggagctagg
aggatgaaatgggctctggagttgagcttgggcaatgctaggggtcgcggagacagacag
agtaaccagggagatgtgatgtaccccattggatactcagacaaaccagtcccagacacc
agcatccaggaaacagacaaaaacctggtggaaaagcgttgttgggacgtggccctgggc
cctctgaagcagattcccatgaacctgttcatcatgtacatgtctggtaacaccatctca
atcttccctatcatgatggtctgtatgatggcctggaggcccatccaggctctcatgtcc
atgtctgccacattcaagctgttggagaactctaaccagcagtggctccaggggctggtc
tattctgtagggaacctgttgggctcggcattggctatctacaagtgtcagtcaatgggt
cttctcccaactcactcttctgattggctcgctttcatagaaccacctcagaggatggag
atcatgggtggagggatggtattgtga

DBGET integrated database retrieval system