KEGG   Salmo salar (Atlantic salmon): 100196160
Entry
100196160         CDS       T04363                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00230  Purine metabolism
sasa00240  Pyrimidine metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100196160 (dck)
   00240 Pyrimidine metabolism
    100196160 (dck)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100196160 (dck)
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Thymidylate_kin PfUIS3 AAA_17 YusW
Other DBs
NCBI-GeneID: 100196160
NCBI-ProteinID: NP_001134661
UniProt: B5XC23
Position
ssa01
AA seq 263 aa
MSPTPPKRAGPSLLNDNMDKTKRISIEGNIAAGKSTFVRLLEEQSKDWEVVPEPIARWCN
VQTQHSEFEELTVSQKNGGNVLQMMYEKPERWAYTFQTYAFMSRVRAQMKSTNGKLREAE
NPVQFFERSVYSDRYIFAANLYESECPNETEWSIYQDWHGWLHEQFGKHIELDGIIYLRA
APERCMERLHRRGREEEQGIPLEYLEKLHFKHESWLQHKTMCMEYKYLNNVPILTLDVNE
DFKVDKVKGEDMVEKVKEFLSTL
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtcgcccacgccgccgaagagagcaggtcctagtctcttaaacgacaatatggacaag
acaaaacgaatttcaatagaaggcaacattgcggcgggcaaatctacattcgtgcgcctt
ctggaagagcagagcaaagactgggaagtagtgcccgaacccatcgccaggtggtgcaat
gtacaaacacaacacagcgagtttgaggagctgaccgtgtcccagaagaatggtggtaac
gtgctgcagatgatgtatgagaagccagagagatgggcctacaccttccagacctacgct
ttcatgagtagggtccgcgcccagatgaaatccaccaatgggaagctcagagaggcagag
aaccccgtgcagttcttcgagcgctccgtctacagtgacaggtacatctttgcggcaaac
ctgtatgagagtgagtgtccgaacgagacagagtggtccatctaccaggactggcacggc
tggctccatgaacagtttgggaaacacatcgagctggatggcatcatctacctccgagcc
gcaccagagagatgcatggagaggctgcatcggagaggcagagaggaggagcagggcatt
ccactggagtacctggagaaacttcacttcaaacacgagagctggctgcagcacaaaacc
atgtgcatggagtataagtatttgaataacgtgcccattctgacgctagatgttaacgaa
gatttcaaagttgacaaggtcaagggtgaggacatggtggaaaaggtcaaagagtttctc
agtaccttgtaa

DBGET integrated database retrieval system