KEGG   Salmo salar (Atlantic salmon): 100196367Help
Entry
100196367         CDS       T04363                                 

Gene name
tnik
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100196367 (tnik)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    100196367 (tnik)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100196367 (tnik)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: STE group
  STE20 family
   100196367 (tnik)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 100196367
NCBI-ProteinID: XP_014055596
UniProt: A0A1S3RTG9
Position
ssa05
AA seq 1259 aa AA seqDB search
MARDCTTRSLDNIDLSALRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
EEEEEIKLEINMLKTYSHHRNIATYYGAFVKKSPAGQDDQLWLVMEYCGAGSVTDLVKKT
KGNCLKEDWIAYICREVLRGLSHLHSHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TIGKRNTFIGTPYWMAPEVIACDENPDSTYDYRSDLWSLGITALEMAEGAPPLCDMHPMR
ALFLIPRNPPPKLKSKKWSKKFLTFVESCLVKNYLHRPATETLLRHSFIKDLPNERQVRI
MLKDHLDRTRKKRDKEGPEYEYSGSEDEEEEMNDEEGEPSSIVNLPGESTLRREFLRLQQ
ENKTRSEAQRQQQVLQQQLQDQERYKQQLLAERQKRIQQQKEQRRRLEDQQRRQLQDSGF
QWPELQEMLWREETEANDRGLFNERSKRRDKKQLEDCGTQRNDVGGRPAGPLNEQRRTEP
PPPLPHPQQQPQQQGKKFHRTLPKDQTQLLSLQHDHRHKQREPQKAASATPNCPANSQCK
AMEMERGKTSDSYQVNLNRVLAGLPLPLHPLPLPLNIHTRLSSGSSSSPCTPAMQRAAIQ
QNANLHSSRDNPHSSSMSDMATTPMSPMFDDVFWDFQNSMECPPKVPERTTSKFYCKELM
SHHRTSSSGGPQSPVEKGGKSMSSHGSSSSSSQSGYFKLESPMLQSRLQQYKKSQETSQA
ALLQQHGFGHLSGVKSNLSPFVKATEYSSSSDEVGSSDDEEKTRSPLSNGKGKFFRGAPD
GIVLQPHHNLNQTPQSSVASGLKSGQPLHRPMAVGSECNENYLLPDLLQKSPAHEPLGQH
RLHDVIFPQSPSGRGPHFDKPVNSPPGKSISSSSSSFTPFIDPRLLQISPPQSPVGYSPT
SGKPLANQEPIRREGHRKGSVVNVNPTNIRPQSDTPEIRKYKKKFNTEILCAGLWGVNLL
VGTENGLWLLDRSGQGKVYSLISRRRFQQMDVLEGLNVLITISGKKNKLRLYYLSWLRNK
ILRNDPEVEKRQGWTSVGDLEGCVHYKVVRYEKIKFLVIALKNAVEVYAWAPKPYHKFMA
FKSFGLLPQRPLSVDLTVEDGQRLKVIYGSLSGFHAIDVDSGTPYDLYLPTHIQGVIRPH
AIIILPNSSGMEVLVCYEDEGVYIDTYGRITKETVLQWGEMPASVAYLQSNQVMGWGDKA
IELRSANTGNLEGVFMHKKAQKLKFLCERNDKVFFASVQSGGSSQIYFMTLGQNSLFNW
NT seq 3780 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgagactgcacaacacgtagtctggataatattgatctctctgctttgagggat
cctgccggaatttttgagctggtagaagtggttggaaatggaacatatgggcaagtctac
aaggggcgacatgtgaagacgggacagctggctgctatcaaggtcatggacgtgacagag
gaggaagaagaggaaataaagttagagattaatatgttgaagacatattcccatcatagg
aatatagctacatactatggtgcctttgtgaagaagagtcctgcaggtcaggatgaccag
ctctggctggtgatggagtactgtggggcgggctcagtcactgacctagtgaagaagact
aaagggaactgcctgaaagaagactggatcgcctacatctgcagggaggtcctcagaggc
ctgtctcacctccactcacaccacgtcattcacagagacatcaaaggccagaacgtgctg
ctgactgagaacgcagaggtcaagctggttgactttggggtgagtgctcagctggacagg
acgatagggaagaggaacacctttattgggactccgtactggatggcccctgaagtcatt
gcttgtgacgagaacccagactctacttatgactacaggagtgacctgtggtcgctggga
atcacagctctggagatggctgaaggagcaccacccctgtgtgacatgcatcccatgaga
gccctgttcctcattcctcgcaacccgccccccaagctcaaatcaaagaaatggtccaaa
aagttcctgacctttgtggagagctgtctggtaaaaaactacctccatcgtcccgccaca
gaaaccctcctgagacactcattcatcaaagacctgcccaacgaacggcaggtccgcatc
atgctcaaagaccacctggacagaacaaggaagaagagagacaaagagggcccggagtat
gagtacagcggcagtgaggatgaggaggaggagatgaacgacgaggaaggtgaacccagc
tccatagtgaacctgccgggggagtccactctaaggagagagttcctgcgtctgcagcag
gagaacaagacccggtccgaagcccagcgacagcagcaggtcctccagcagcagctccag
gaccaggagaggtacaaacagcagctgctggccgagaggcagaagaggatccaacagcag
aaagagcagcgcaggaggctggaggatcaacaaaggaggcagctgcaggattctgggttc
caatggccagagctacaggagatgctatggagggaggagactgaagctaatgacagaggt
ctattcaatgagaggagcaagagaagggacaagaaacagctggaggattgtggcacacag
aggaatgatgtcggaggaagacctgcaggtcctttaaatgaacagaggaggaccgagcct
ccacctccactgcctcatcctcagcagcagccccagcagcagggtaaaaagttccaccgc
acgctgcccaaagaccaaacgcagctgctttcgcttcagcacgaccacagacacaaacag
agggagccccagaaggctgctagtgccacgcctaactgccctgcaaatagccagtgcaaa
gcgatggagatggaaagggggaagacctctgacagctatcaggtcaacctgaacagagtg
ttggctgggctgccccttcccctacacccccttcctctccccctaaacatccataccaga
ctgagctccgggagcagctccagcccctgtacccctgccatgcagagggccgccatacaa
cagaatgccaatcttcactccagtcgcgataaccctcacagcagctctatgtctgacatg
gccaccactcccatgtctcctatgtttgacgatgtcttctgggacttccaaaactctatg
gagtgcccaccaaaggttccggagcgtacaacatcgaaattctattgtaaagagctgatg
agtcatcaccggacttcatcaagtgggggccctcagtctcctgtggagaagggtgggaaa
tccatgtcatctcacggaagctccagcagcagctcccagtcaggttacttcaagctggag
agccctatgctgcagagccgtcttcaacagtacaagaagtctcaggagacttctcaagca
gccctgctgcagcaacatggtttcggccacttatctggggtcaagtccaatctcagtccg
tttgtcaaggcaacagagtactcctcttccagtgatgaagtcgggagtagtgacgatgag
gagaaaaccaggtctccattgagtaatgggaagggcaagttcttccgaggagcccccgat
gggattgtcctgcagccccatcataatctcaaccaaaccccgcagagcagcgtggcatca
ggccttaagagtggccagccactacacaggcccatggctgtaggatcagaatgcaatgag
aattaccttctccctgatcttctgcagaagagcccggcccatgagcccctggggcagcac
agactgcatgacgtcatcttcccccagtctccgagcggacgaggaccgcactttgataag
cctgtaaacagtcctccagggaaaagcatctcgtcctcctcctcctccttcactcccttc
attgaccccaggctgctgcaaatctctccccctcagagcccagtgggctacagtcccacg
agtggcaagccgctcgctaatcaggagccaatcaggagagaggggcacaggaagggctcc
gtggttaacgtgaaccccaccaacatcagaccccagagcgacacccccgagatccgcaag
tacaagaagaagttcaacaccgagatcctctgtgctggactgtggggtgtgaacctgctg
gtggggacagagaatggtctgtggctgctggacaggagcggtcaggggaaggtctactct
ctgatcagcaggagacgcttccaacagatggacgttcttgagggcctcaatgtgctcatc
accatctcaggtaagaagaacaagctgaggttgtactacctgtcgtggctacggaacaag
atcctacggaacgacccagaggtggagaaaaggcagggctggacttcagtaggagacctg
gaaggatgtgtgcactacaaagtcgttcgatatgagaagattaagttcctggtgattgcc
ttgaagaatgctgtggaggtgtatgcatgggctcccaagccttaccacaagttcatggct
ttcaagtcgttcggcttgctcccccagaggcctctgtctgtggacctgacggtggaggat
ggacaaagactcaaggtcatctacggctctctgtcgggcttccacgccatcgacgtggac
tcggggacgccctacgacctctacttgccaacgcacatccagggtgtgatccggccccat
gccatcatcatcctacccaacagcagtggcatggaggttctggtgtgttatgaagacgag
ggggtctacatagacacctatggacgcatcaccaaggaaacagtgctgcagtggggagag
atgcctgcatctgtcgcctacctgcagtccaaccaggtgatgggctggggagacaaagcc
atcgagctgaggtcagctaacacaggcaaccttgagggagtcttcatgcacaagaaggcc
cagaaactcaaattcctgtgtgagaggaatgacaaggtgttctttgcctcagtgcagtca
ggtggcagcagccagatctacttcatgacactgggccaaaactctctgttcaactggtga

DBGET integrated database retrieval system