KEGG   Salmo salar (Atlantic salmon): 100196655Help
Entry
100196655         CDS       T04363                                 

Gene name
hsp70-3
Definition
(RefSeq) heat shock protein 70
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa03040  Spliceosome
sasa04010  MAPK signaling pathway
sasa04141  Protein processing in endoplasmic reticulum
sasa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100196655 (hsp70-3)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100196655 (hsp70-3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100196655 (hsp70-3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100196655 (hsp70-3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    100196655 (hsp70-3)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sasa03041]
    100196655 (hsp70-3)
   03009 Ribosome biogenesis [BR:sasa03009]
    100196655 (hsp70-3)
   03110 Chaperones and folding catalysts [BR:sasa03110]
    100196655 (hsp70-3)
   04131 Membrane trafficking [BR:sasa04131]
    100196655 (hsp70-3)
   03051 Proteasome [BR:sasa03051]
    100196655 (hsp70-3)
   03029 Mitochondrial biogenesis [BR:sasa03029]
    100196655 (hsp70-3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100196655 (hsp70-3)
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100196655 (hsp70-3)
Spliceosome [BR:sasa03041]
 Complex B
  Other components
   Prp19 complex
    100196655 (hsp70-3)
 Complex C
   Prp19-CDC5 complex
    100196655 (hsp70-3)
Ribosome biogenesis [BR:sasa03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100196655 (hsp70-3)
Chaperones and folding catalysts [BR:sasa03110]
 Heat shock proteins
  HSP70 / DNAK
   100196655 (hsp70-3)
Membrane trafficking [BR:sasa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100196655 (hsp70-3)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100196655 (hsp70-3)
Proteasome [BR:sasa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100196655 (hsp70-3)
Mitochondrial biogenesis [BR:sasa03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100196655 (hsp70-3)
Exosome [BR:sasa04147]
 Exosomal proteins
  Proteins found in most exosomes
   100196655 (hsp70-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C CRIC_ras_sig DUF1464 CENP-X
Motif
Other DBs
NCBI-GeneID: 100196655
NCBI-ProteinID: NP_001135156
UniProt: B5DG30
Position
ssa05
AA seq 651 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRKFDDAVVQSDMKHWPFTVVSDGGKPKMEVEYKGERKTFFPEEVS
SMVLTKMKEISEAYLGKPVNNAVITVPAYFNDSQRQATKDAGVISGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIGEFKRKFKKDISGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGADFYTSITRA
RFEELNADLFRGTLEPVEKSMRDAKMDKAQIHDIVLVGGSTRIPKIQKLLQDLFNGRDLN
KSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSENQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLTKEDIERMVQEADQYRAEDEAQKEKVTAKN
SLESLAFNMKSTVDDEKLAEKISPEDKKTIVDKCNEVISWLDRNQTAEKDEYEHQQKELE
KVCNPIITNLYQGTGGPPGGMPGGMPGGMPGGFPGGAGAGSSSGPTIEEVD
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggaccagcagtaggcattgacctggggaccacatactcctgtgtgggcatc
tttcagcatggcaaggtggagatcatcgccaacgaccagggcaacagaaccacacccagc
tatgtggccttcaccgacacggagaggctgatcggtgacgccgccaagaaccaggtggcc
atgaaccccaccaacactgtgttcgatgccaagcgtctaattggtcgtaagtttgatgat
gccgtggtacagtcggacatgaagcactggcccttcacagtggtgagcgatggtggcaag
cccaagatggaggtagagtacaagggagagaggaagacctttttccctgaggaggtgtcc
tccatggtgctcaccaaaatgaaggagatctctgaagcttatctgggcaagccagtgaac
aatgctgtcatcacagtccctgcctacttcaacgactcccagcgccaagcaaccaaagat
gctggagtgatctctggactcaacgtcctgcgcatcatcaacgagcccaccgctgcagcc
atcgcctatggcctggacaagaaggtcgggggtgagcgcaacgtcctgatcttcgacctg
ggcggcggcacctttgacgtgtccatcctgaccatcgaggatggcatctttgaggtgaag
tccactgctggtgacacccacctgggaggcgaggacttcgacaaccgcatggtcaaccac
ttcatcggtgagttcaagcgtaaattcaagaaggacatcagcggcaacaagcgtgcggtg
cggcgcctgcgcactgcctgtgagcgggccaagcgcaccctctcctccagcacccaagcc
agcatcgagattgactccctctatgagggtgccgacttctacacctccattaccagggct
cgctttgaggagctcaacgctgacctgttccgcggtaccctggaacccgtggagaagtct
atgagagatgccaaaatggacaaggcccagatacacgacatcgtcctggtgggaggctcc
acacgtatccccaagatccagaagcttctgcaggacttattcaatggccgagacctcaac
aagagcatcaaccctgatgaggctgtggcttatggtgccgctgtgcaggctgccatctta
gccggtgacaagtcagagaacgtgcaggacctgctgctgctggacgtcacacccctgtcc
ctgggtattgagacagctggaggggtcatgaccgtgctcatcaagaggaacaccaccatc
cccaccaagcagacccagaccttcacaacatactcagaaaaccaacccggagtgctcatc
caggtgtatgagggggagagagccatgaccaaggacaacaatatccttggcaagtttgag
ctcaccggaatcccccctgcccccaggggcgtcccccagatcgaggtgacctttgacatt
gacgccaacggcatcctcaatgtgtctgcggtggacaagagcaccggcaaggagaacaag
atcaccatcaccaatgacaaaggacgtctgaccaaggaggacattgagcgcatggtgcaa
gaggctgaccagtacagggctgaggacgaggctcagaaggagaaggtcacagctaagaac
tcactggagtccctggccttcaacatgaagagcaccgtggatgacgagaagctcgcggaa
aagatcagcccggaggacaagaagaccatcgtggacaagtgcaacgaagtgatctcctgg
ctggacaggaaccagacagcagagaaggatgagtatgagcaccagcagaaggagctggag
aaggtgtgtaaccccatcattaccaatctgtatcagggtaccggaggcccaccaggaggt
atgccaggcggtatgccaggcggtatgcctggaggcttccctggaggtgctggggctggc
tcttcctctggtccaaccatcgaggaggttgactaa

DBGET integrated database retrieval system