KEGG   Salmo salar (Atlantic salmon): 100196702Help
Entry
100196702         CDS       T04363                                 

Gene name
g6pd
Definition
(RefSeq) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00030  Pentose phosphate pathway
sasa00480  Glutathione metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sasa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    100196702 (g6pd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100196702 (g6pd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100196702 (g6pd)
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     100196702 (g6pd)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     100196702 (g6pd)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100196702 (g6pd)
  Exosomal proteins of colorectal cancer cells
   100196702 (g6pd)
  Exosomal proteins of bladder cancer cells
   100196702 (g6pd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 100196702
NCBI-ProteinID: NP_001135196
UniProt: B5X1I3
Position
ssa13
AA seq 519 aa AA seqDB search
MAGRKLSAIPLSRSEVFGELRKELHDDKEFHHSDAHIFIIMGASGDLAKKKIYPTLWWLF
RDGLLPEQTYFVGFARSDLTVDAIKTASMPYMKVADSEAERLSVFFSRNSYVSGKYTEES
AFSNLHTHLLSLPGGGKANRLFYLALPPSVYHDVTKNIKHHCMSTKGWSRVIVEKPFGRD
LQSSEELSTHLSSLFTEDQIYRIDHYLGKEMVQNLMVLRFGNRIFGPIWNRDSIACVVLT
FKEPFGTQGRGGYFDDFGIIRDVMQNHLLQMLSLVAMEKPASTSSDDVRDEKVKVLKCIA
PITMSDVVLGQYVGDPEGEGDAKLGYLDDPTVPKGSTQATFTTAVLYVHNERWDGVPFIL
RCGKALNERKAEVRLQFTDVPGDIFGAQCRRNELVVRVQPNEAVYAKMMSKKPGVYFHPE
ETELDLTYKSRYKDVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIESEK
PPPTPYIYGSRGPTEADELSKRVGFHYEGTYKWVNPHRL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggctggaagaaaattgagtgccattcccctctctcggtccgaggtgttcggagagctg
cgaaaagagctgcatgatgacaaggagtttcatcactccgacgctcacatcttcatcatc
atgggagcatcgggagatctagccaaaaagaaaatctacccaactctgtggtggttgttt
agagatggtctcctccctgaacagacttactttgtgggctttgcccgctctgacctgacg
gtggatgccatcaaaactgcctccatgccctatatgaaggtggcagactctgaggcggag
cggttgtctgtgttcttcagccgtaactcttatgtcagtgggaagtacactgaggagagt
gccttctccaacctccacacccacctgttgtccctgcccggggggggcaaggccaaccgc
ctcttctacctcgccctgccgcccagcgtctaccacgacgtcaccaagaacatcaagcac
cactgcatgagtaccaagggctggagcagagtgattgtggagaagccatttggtcgtgac
ctgcagagctcagaggagctgtccacccacctctcttccctgttcactgaggaccagatc
taccgcatagaccactacctgggcaaggagatggtgcagaacctcatggtcctcaggttt
gggaaccggatctttgggcccatctggaacagggacagcatagcttgtgtggtcctcacc
ttcaaagaacccttcggcacccagggccggggcggctattttgacgactttggaatcatc
cgggatgtcatgcagaaccacttgctccagatgctctcgctggttgccatggagaagcct
gcctccaccagctctgatgatgtcagggatgaaaaggtgaaggtgctgaagtgcattgcc
cccattaccatgtcagatgtggtgttggggcagtatgtgggtgacccagagggagagggg
gatgccaagctgggttaccttgacgaccccactgtccccaaaggctccacccaggccacc
ttcaccacagctgtgctctacgtgcacaacgagcgctgggatggtgttcccttcatcctg
cgttgcggcaaagccctgaacgagcggaaagcggaggtgcggttgcagttcacggatgtt
ccgggggacatctttggagcgcagtgtcgtaggaatgagctggtggtgcgtgtgcagccc
aacgaggccgtctacgccaagatgatgagcaagaaaccaggagtgtatttccacccagag
gagacagagctggacctcacctacaaaagcagatataaggatgtgaagttgcccgacgcc
tacgagcgtctcatcctggacgtcttctgtggcagccagatgcactttgtcagaagtgat
gagctgagggaagcctggaggatctttacgcctctccttcatcagatcgagagcgagaag
cctccccccaccccctacatatatggaagccggggtccaacagaagcagatgagctttca
aagagggtcggtttccactatgaaggaacatacaaatgggtcaacccccacagactgtga

KEGG   Salmo salar (Atlantic salmon): 106571947Help
Entry
106571947         CDS       T04363                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00030  Pentose phosphate pathway
sasa00480  Glutathione metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sasa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106571947
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106571947
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106571947
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     106571947
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     106571947
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   106571947
  Exosomal proteins of colorectal cancer cells
   106571947
  Exosomal proteins of bladder cancer cells
   106571947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-GeneID: 106571947
NCBI-ProteinID: XP_014001019
UniProt: A0A1S3MD97
Position
ssa15
AA seq 536 aa AA seqDB search
MGSASSAERPAGGAIAQQGPGKMSSIPLSRSEVFGELRKELHEDEEFRQSDAHIFIIMGA
SGDLAKKKIYPTLWWLFRDGLLPEQTHFVGFARSDLTVDAIKTACMPYLKVADSEAERLS
VFFSRNSYVSGKYADESAFSNLHTHLLSLPGGGEANRLFYLALPPSIYHDVTKNIKHHCM
STKGWNRVIVEKPFGRDLQSSEELSTHLSSLFTEDQIYRIDHYLGKEMVQNLMVLRFGNR
IFGPIWNRDSIACVVLTFKEPFGTQGRGGYFDDFGIIRDVMQNHLLQMLSLVAMEKPAST
SSDDVRDEKVKVLKCIAPITMSDVVLGQYVGDPEGEGDAKLGYLDDPTVPKGSTQATFAT
AVLYVHNERWDGVPFILRCGKALNERKAEVRLQFTDVPGDIFGAQCRRNELVVRVQPNEA
VYAKMMSKKPGVYFHPEETELDLTYKSRYKDVKLPDAYERLILDVFCGSQMHFVRSDELR
EAWRIFTPLLHQIENEKTPPTPYKYGSRGPTEADELSKRVGFRYEGTYKWVNPHRL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgcatcgagcgccgagagacctgccggtggtgccattgcacaacaaggaccc
ggaaaaatgagctccattcccctctctcggtccgaggtgttcggggagctgcggaaggag
ctgcatgaggatgaggagttccgtcagtccgatgctcacatcttcatcatcatgggagca
tcgggggatctagccaaaaagaaaatctacccaactctatggtggttgtttagagatggg
ctccttcctgaacagactcactttgtgggctttgcccgctctgacctcacggtggatgcc
atcaaaactgcctgcatgccctatctgaaggtggcagactctgaggcggagcggttgtct
gtgttcttcagccgtaactcttacgtcagtgggaagtacgcggatgagagtgccttctcc
aacctccacacccacctgttgtccctgcccgggggtggtgaggccaaccgcctcttctac
ctggccctgccgcccagcatctaccacgatgtcaccaagaacattaagcaccactgcatg
agcaccaagggctggaacagggtgattgtggagaagccgtttggtcgtgacctgcagagc
tctgaggagctgtccacccacctctcctccctgtttactgaggatcagatctaccgcata
gaccactacctgggcaaggagatggtgcagaacctcatggtcctcaggtttgggaaccgg
atctttgggccaatctggaacagggacagcatagcgtgtgtggtcctcaccttcaaagaa
cccttcggcacccagggccgaggcggctactttgacgactttggcatcatccgtgatgtc
atgcagaaccacttgctccagatgctctctctggttgccatggagaagccggcctccacc
agctctgatgatgtcagggatgaaaaggtgaaggtgctgaagtgcatcgcccccattacc
atgtcagatgtggtgttggggcagtacgtgggcgacccagagggagagggggacgccaag
ctgggttaccttgatgaccccactgtccccaaaggctccacccaggccacctttgccaca
gctgtgctctacgtgcacaacgagcgctgggatggtgttcccttcatcctgcgttgcggc
aaagccctgaatgagcggaaagcggaggtgcggttgcagttcaccgacgtcccgggggac
atctttggtgcgcagtgtcgtaggaatgagctggtggtgcgcgtacagcccaatgaggcc
gtctacgccaagatgatgagcaagaaaccaggagtgtacttccaccccgaggagacggag
ctggacctcacctacaagagcagatacaaggatgtgaagttgccagacgcctacgagcgt
ctcatcctggacgtcttctgtggcagccagatgcactttgtcagaagtgatgagctgagg
gaagcctggaggatctttacgcctctccttcatcagatagagaacgagaagactcccccc
acaccctacaaatatggaagccggggtccaacggaagcggacgagctctcaaagagggtc
ggtttccgttacgaaggaacatacaaatgggtcaacccccaccgactgtga

KEGG   Salmo salar (Atlantic salmon): 106572705Help
Entry
106572705         CDS       T04363                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00030  Pentose phosphate pathway
sasa00480  Glutathione metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sasa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106572705
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106572705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106572705
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     106572705
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     106572705
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   106572705
  Exosomal proteins of colorectal cancer cells
   106572705
  Exosomal proteins of bladder cancer cells
   106572705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N FlaA
Motif
Other DBs
NCBI-GeneID: 106572705
NCBI-ProteinID: XP_014002583
UniProt: A0A1S3MH94
Position
ssa15
AA seq 541 aa AA seqDB search
MRQHDTETAEREPGLTYSTETTHQMEKMSGVPGCLTHSEVLGQLRRELSHSSDLHIFIIL
GASGDLANKKIYPTLWWLFRDELLPEETHFVGFARSKLTMEDIRTACLPHMKVGDGESER
LAAFFSRNSYLSGRYDEEDSFSELNAHLSSLTTSRGADHANCIFYLALPPSVYHHVSKNI
RAHCMCRKGWSRVIVEKPFGRDLQSSQELSSHFSSLFREDQIYRIDHYLGKEMVQNLMVL
RFGNRIFGPIWNRNSVACVVLTFKEPFGTQGRGGYFDDFGIIRDVMQNHLLQMLSLVAME
KPASTSPDDVRDEKVKVLKCIAPVPRSDVVLGQYIGDPEGESHARLGYLDDPTVPNGSRT
PTFATSVLYVQNERWDGVPFVLRCGKALNERKAEVRLQFTDVPGDIFNEQCQRNELVVRV
QPDEAIYLKMMTKKPGAYFSPEETELDLTYRSRYKDVKLPDAYERLILDVFCGNPMHFVR
SDELREAWRIFTPLLHHIEGEKTPPISYTYGSRGPNEADELVRRVGFRYEGTYKWVNPHS
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacacgacacagagacagcagagagggaaccaggcttgacatacagtacagag
acaacacaccagatggagaagatgagtggtgttcctgggtgtctcacccactctgaggta
ttgggtcagctgagaagagagctgtcccattcatctgacttacacatcttcatcatactg
ggagcctcaggagatcttgccaataagaagatctatcctactctatggtggctgttcaga
gatgagcttctcccagaagagacccactttgtgggctttgctcgctccaagctgaccatg
gaggacatcaggacagcatgtctgccacatatgaaggttggtgatggtgagagtgagcgc
ctcgctgcgttcttcagtaggaactcttacctgagtggcaggtatgatgaggaggactcc
ttctctgagctgaatgcccacctgagctccctgaccaccagcaggggggctgaccatgct
aactgtatcttctacctggcactgccccccagcgtctaccatcatgttagcaagaacatc
agagcccactgcatgtgccgcaaaggttggagcagggtgatagtggagaagccatttggt
cgtgacttgcagagttctcaggagctgtcgtcccacttctcctccctgttcagagaagac
cagatctaccgcatagaccactacctgggcaaggagatggtgcagaacctcatggtcctc
aggtttgggaaccgtatctttggtcctatctggaacaggaacagcgtggcctgtgtggtt
ctaacctttaaagaaccattcggtacacagggacgcggaggatactttgatgactttggc
attatccgtgatgtcatgcagaaccacctcctccagatgctctctctggttgccatggag
aagcctgcctccaccagccctgatgacgtcagagatgagaaggtgaaggtgttgaagtgc
atcgccccagtgcctcggtctgatgtggtgctgggtcagtacataggggaccctgagggg
gagagccatgccagactgggttacctagacgaccccaccgtgcccaacggctcccggacg
cctaccttcgccacctctgtgctctacgtacagaatgagagatgggatggtgttccgttc
gtcctgcgttgcggtaaggcactcaacgagcgtaaggcggaagtgcgtctccagttcacg
gatgttccaggggacatctttaatgagcagtgccagaggaatgagctggtggtgagggta
cagcctgatgaggccatctacctcaagatgatgaccaagaagcctggagcttacttcagc
cctgaggagactgaactggaccttacctacaggagcagatacaaggacgtgaagctccct
gatgcatatgagcgtcttattctggatgtgttctgtgggaatccgatgcactttgtccgc
agtgatgagctgcgagaagcctggaggatcttcactcccctcctccatcacatagaggga
gagaaaacacctcctatctcttacacctatggaagtcgtggaccaaatgaagcggatgag
ctcgtgaggagggtgggattccgctacgagggaacatacaagtgggtcaacccccacagt
gcatga

KEGG   Salmo salar (Atlantic salmon): 106599940Help
Entry
106599940         CDS       T04363                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00030  Pentose phosphate pathway
sasa00480  Glutathione metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sasa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106599940
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106599940
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106599940
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     106599940
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     106599940
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   106599940
  Exosomal proteins of colorectal cancer cells
   106599940
  Exosomal proteins of bladder cancer cells
   106599940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C
Motif
Other DBs
NCBI-GeneID: 106599940
NCBI-ProteinID: XP_014046755
UniProt: A0A1S3R315
Position
Un
AA seq 139 aa AA seqDB search
MQNHLLQMLSLVAMEKPASTSSDDVRDEKVKVLKCIAPITMSDVVLGQYVGDPEGEGDAK
LGYLDDPTVPKGSTQATFTTAVLYVHNERWDGVPFILRCGKALNERKAEVRLQFTDVPGD
IFGAQCRRNELVVRVQPNE
NT seq 418 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccacttgctccagatgctctcgctggttgccatggagaagcctgcctccacc
agctctgatgatgtcagggatgaaaaggtgaaggtgctgaagtgcattgcccccattacc
atgtcagatgtggtgttggggcagtatgtgggtgacccagagggagagggggatgccaag
ctgggttaccttgacgaccccactgtccccaaaggctccacccaggccaccttcaccaca
gctgtgctctacgtgcacaacgagcgctgggatggtgttcccttcatcctgcgttgcggc
aaagccctgaacgagcggaaagcggaggtgcggttgcagttcacggatgttccgggggac
atctttggagcgcagtgtcgtaggaatgagctggtggtgcgtgtgcagcccaacgagg

DBGET integrated database retrieval system