KEGG   Salmo salar (Atlantic salmon): 100306748Help
Entry
100306748         CDS       T04363                                 

Gene name
khk
Definition
(RefSeq) ketohexokinase
  KO
K00846  ketohexokinase [EC:2.7.1.3]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00051  Fructose and mannose metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    100306748 (khk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    100306748 (khk)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.3  ketohexokinase
     100306748 (khk)
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100306748 (khk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Germane
Motif
Other DBs
NCBI-GeneID: 100306748
NCBI-ProteinID: NP_001158759
UniProt: C0H8G6
Position
ssa01
AA seq 302 aa AA seqDB search
MGDKKILCIGLVCLDIINVVDKYPEEDTDTRCLSQRWQRGGNASNSCTVLSLLGAPCAFM
GSLAPGHVADFIVGDFSRRGVDISSVAWQREGETPCACCVVCPPSGSRTVVLSDTNLPDV
SATDFSKVDLSQYKWIHWEGRNAEEQVKMIQQVELSNDTLPQQQRITVSVEIEKTREPLY
QLFQHGDVVFVSKDVAMHFGFHSAASALKGLYHRVKKGAVLICAWAEKGADAMGPDGIVV
HSDAFPPEAVVDTLGAGDTFNASVIYTLSNGGGVQEALTFGCQVAGRKCGVHGYDEIVTK
KE
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacaaaaagatactgtgcatcgggctggtatgtctggatattatcaatgtagtg
gacaaatacccggaagaggacactgacaccaggtgtttgtctcaacgatggcagcgtggt
gggaacgcgtccaactcgtgcactgtgctgtcactccttggcgctccctgtgcgttcatg
gggtccctagctcctgggcatgttgcagacttcatcgtgggcgatttctctcgccgcggg
gtggacatttcgtccgttgcctggcagcgggagggggagaccccatgtgcgtgttgcgtg
gtgtgtccccccagcggctcacgcacggtcgtgctctccgacacgaacctacctgatgtg
tcagcaacagacttctctaaggtagatctcagtcagtacaaatggatccactgggagggc
cgtaatgctgaggagcaggtgaagatgatccagcaggtggagctgtctaacgacactttg
ccacagcaacaaaggatcaccgtatccgtggagatagagaagaccagggagcctctgtac
cagctcttccaacatggtgatgtggtgtttgtcagtaaggatgtggccatgcactttggc
ttccactctgctgccagtgctctgaagggcctctaccacagagtgaagaaaggggctgtc
ctcatatgtgcctgggcagagaaaggggcagatgcgatgggtcctgatggcatagtggtc
cactcagatgcctttccgccggaggccgttgtggacacgctcggagcaggcgacactttc
aatgcatcagtgatctacaccctgtcaaatggaggaggagtacaggaagctctcacattc
ggttgccaggtggcaggcaggaagtgtggtgtccacggatatgatgaaatagtgacaaag
aaagagtga

DBGET integrated database retrieval system