KEGG   Salmo salar (Atlantic salmon): 106560340Help
Entry
106560340         CDS       T04363                                 

Gene name
st3gal3
Definition
(RefSeq) ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00513  Various types of N-glycan biosynthesis
sasa00514  Other types of O-glycan biosynthesis
sasa00515  Mannose type O-glycan biosynthesis
sasa00533  Glycosaminoglycan biosynthesis - keratan sulfate
sasa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    106560340 (st3gal3)
   00515 Mannose type O-glycan biosynthesis
    106560340 (st3gal3)
   00514 Other types of O-glycan biosynthesis
    106560340 (st3gal3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    106560340 (st3gal3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106560340 (st3gal3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    106560340 (st3gal3)
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     106560340 (st3gal3)
Glycosyltransferases [BR:sasa01003]
 Terminal extension
  Sialyltransferase
   106560340 (st3gal3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 106560340
NCBI-ProteinID: XP_013978648
UniProt: A0A1S3KIT5
Position
ssa10
AA seq 364 aa AA seqDB search
MRIMKPTRHLLLVLCPMLVLGFLYYSSGRLHLRGWGQKSLYDKQGFLLKLGGNLPLELMY
KYGNLSEGVCKPGYAAAKMTTIYPMFAKPAPMFLDPNFRRFSKISNFSPPFGMKTQEKII
DNILTATKSYGLGDELDSQSCKKCIIMGNGGILANKSMGVKIDEYDVIARLNEAPVSGYE
KDVGSKTTMRITYPEGAIQKTERYEQDSLFVLSAFKALDFKWLRSIIFKERLHSTEGFWK
SVARHVPREPSEMRILNPYFIQEAAFRFIGLPHNNGQMGRGNIPTLGTVAITMALHNCDE
VAVAGFGYDMSTPHAPLHYYEKIRMAAIKESWTHNISKEKEFLIKLVKAGVIQDLTNGIC
GSGC
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagaatcatgaagccaacccggcacctgctcctggtgctctgtcccatgcttgtcctg
ggcttcctctactactcctctgggagactgcacctgaggggctggggacagaaatcactg
tatgacaaacagggattcttgctgaagctgggtggtaatctacctttggagctgatgtac
aagtatggtaatctcagcgagggagtctgtaaacctggctacgcagctgccaagatgacc
accatctatccaatgttcgctaaaccagcccccatgttcctcgatccaaactttagacga
ttctccaagatcagcaacttttccccaccttttggaatgaaaacgcaagaaaagatcata
gataatattctgacagcaacaaagagctatggtctgggagatgagctggacagtcagagt
tgtaagaagtgcatcatcatgggaaatggtggtattctggccaacaagtctatgggtgtg
aagattgacgagtacgatgtgattgcaaggttgaacgaggctccagtgtctggctatgaa
aaggatgtgggctccaagaccaccatgcgtatcacgtacccagagggagccatccagaag
actgaacgctacgaacaggactccctcttcgtcctctctgccttcaaagctctcgacttc
aaatggctgcggtccataatctttaaggagagactgcatagcacagaagggttctggaag
tctgtggcccgtcatgtccccagggagcccagtgagatgaggatcctcaacccttacttc
atccaggaggctgccttcaggttcatcggcctgcctcacaacaatggacagatggggaga
gggaatattccgacactggggacggttgccataacaatggccctccataactgtgatgag
gtagccgtggctggatttggctatgacatgagcacccctcacgcccccctacactactac
gagaagatcaggatggcggccatcaaagagtcctggactcacaacatttctaaggagaag
gagttcctgattaagctggtgaaggctggggttatacaggacttgaccaatgggatctgt
ggctcaggatgctga

DBGET integrated database retrieval system