KEGG   Salmo salar (Atlantic salmon): 106560490Help
Entry
106560490         CDS       T04363                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106560490
Membrane trafficking [BR:sasa04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106560490
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 106560490
NCBI-ProteinID: XP_013978930
UniProt: A0A1S3KJY9
Position
ssa10
AA seq 2111 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLLKNLNVGAAASNTVPLTEAVEPVDFEE
YLITHPPIIESGPLRDLIEFPPDDIEVVCTPRECRTVGQAVPEEGDNDAHVRDCVRSYTE
DWAIVNRKYHKLGTGFNPNTLDRQKERQKGLPKQVFEADEMPDVSTYQDDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSVPDAVLPHLLDRAPNEEIDRHNEEHRKSHRHRELFALHPAL
DEEEPIERHCVPDVPKEHFGQRLLVKCLSLKFEIEIEPIFACLALYDVKEKRKISENFFF
DLNSEQTKGMLRPHIQTAAISTLARSAIFSITYPSQDVFLVIQLEKVLQQGDIGECAEPY
MVFKESDAAKNKEKLDKLRSQSEQFCTRLGRYRMPFAWTAIHLMNIVNSAGSLERDTELE
MGLPERKGSWSERRNSSIGGRRSLERTTSGDESCSLTSFRPATLTVTNFFKQEGDRLSDE
DLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPDLQQVKPYPDSRVRPTR
EILEFPPRDVYVPNTTYRNLLYVNPHSLNFANRQGSARNITVKVQFMNGEDPNNAMPVIF
GKSSCGDYTREAYTAVVYHTRSPDFHDEVKIKLPASLTDHHHVLFTFYHVSCQQKQNTPL
ETPVGYTWIPMLQNGRLRTGSFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
VTSVSTVHTQDQYLDKFFALVHALDEHMFPVRIGDVRIMENNLEAELKSSIAALNSSQLE
PIVRFLHLLLDKLVVLVVRPPVIAGQIVNLGQASFEVMASIVNRLHKYLDTSQDMHGRNS
LLSSYIYYVFRLPNMDPNFPSPGPGGLGGSVHYATMARSAQRPASLNLNRSRSLSNSNPD
ISGTPTSPDDEVRSIIGSKAMERCGNRMSSHTESTSFLQTLTGRLPTKKLFHEELALQWV
VSSGSVREGALQQAWFFFELMVKSIIHHLYFTDRLESPRKNRFPERFMDDITALVSTIAG
DIVSRFQKDLELVERLNTSLAFFLNDLLSVMDRGFVFSLIKTYWKQVSTKLYMLQNPTLE
SLRLDLLRIVCSHEHYVTLNLPCSLLTPPASPSPSVSSATSQSSGFSTHAQDQKIANMFE
LSVPFREQHYLAGLVLSELAVILDPEAEGMFGLHKKVVSVVHNLLSSHDSDPRYADPEVK
ARVAMLYLPLIGIVMETLPQLHDFTESHNQWGRPGGAQGATGGAGGDESGEDGNSMISQT
VAMAIAGTSAPISRPSSFLLNPQASRQHGTFSAESSRSLLICLLWVLKNADECVLQKWFS
DLSVSQLNRLLDMLYLCVSCFEYKAHVVFTMQGKKAFERMNSLTFKKSKDMKVKLEEAIL
GSIGARQEMVRRSRGQLGTLERSPSGSAFGSQENLRWRKDMTHWRQNSERMDKTRAELEH
EALIDGNLATEANLIILDTLEIIVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHC
FATQRAIVSKFPELLFEEETEQCADLCLRLLRNCSSSIGTIRAHASASLYLLMRQNFEIG
NNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYGEEDLELRETTFPDQVQDLVF
NLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERTNHAEA
AQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGK
YFTEAGLVGLLDQAASSFSMAGMYEAVNEVYKVLIPIHEASRDAKKLATIHGKLQEAFGK
IVHQDGKRMFGTYFRVGLYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERYGEDQ
VEVIKDSNPVDKCKQDPNKAYVQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTL
DGRAHGDLHDQFKRKTILTTSHAFPYIKTRINIIHKEEIISMPIEVAIEDMQKKTGELAF
ATHQDPSDAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFT
KRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLICRKIPQLYKPVLQVNSHRDS
FSRMSLRKLEL
NT seq 6336 nt NT seq  +upstreamnt  +downstreamnt
atggctgagcgccgcgcattcgcccaaaaaatcagcagaactgtagcagccgaggtgaga
aaacagatcgctggtcagtatgggggctccccacagctcctcaagaacctcaacgtgggt
gctgccgccagcaacaccgttcctctcacagaggcagtggaaccggtggactttgaggag
tacctcatcacccatccccccatcatcgagtcgggccccctgagggacctgatcgagttc
cccccagacgacatcgaggtggtctgcacccccagagagtgtcgcacagtgggacaggcc
gtgcctgaggaaggggacaatgacgcccacgtcagagactgtgtcaggtcctacactgag
gactgggccatcgtcaacagaaaataccataagcttggtacaggatttaaccctaacacc
ctggacaggcagaaggagaggcagaaaggcctgcccaaacaggtgtttgaggccgatgag
atgccagacgttagcacttaccaggacgaccaggatgatctgaagcgtaggtccatgtcc
atagacgacaccccgcgtggcagctgggcctgtagtatctttgacctgaagaactctgtc
cccgacgccgtcctgccccacctgcttgaccgggcccccaacgaggagatagaccggcac
aacgaggagcaccgcaagtcccaccgccaccgtgagctcttcgccctgcaccccgccctt
gatgaggaagaacccatcgagcgccactgtgtgcctgacgtccctaaggaacattttggc
cagaggctactcgtcaagtgcttgtccttgaagtttgagattgaaattgagcccatattc
gcctgtttggccttatatgatgtcaaggaaaagagaaagatatcggagaactttttcttt
gacctgaactcggagcagaccaaagggatgctgcgccctcacatccagacagcagccatc
tctactctcgcccgctccgcaattttctccattacatacccctcccaggacgtcttcctc
gtcatacagctggagaaggtgttgcagcagggagacataggagagtgtgcagaaccgtac
atggtcttcaaagagtctgatgcagctaaaaacaaagaaaagttggacaagttgcggagc
cagtcggagcagttctgcacacgtctgggtcggtaccggatgcccttcgcctggacagcc
atccacctgatgaacatcgtgaacagcgccggcagtctggagagagacactgagctggag
atgggacttccagagaggaaagggtcgtggtctgagaggaggaactcgagcatcggtgga
cggcgctcattagagagaaccaccagtggagatgaatcatgtagcctgaccagcttcaga
cctgcaaccctcaccgtcaccaatttcttcaaacaggagggagacagactgagtgatgag
gacctgtataagttcctggctgacatgaggaggccgtcttcagtgctgaggagactgagg
ccaatcacagcccagctgaagatcgacatatccccggccccagagaacccccactactgc
ttgacccctgacctccagcaggtcaagccctacccagacagcagggttcgccccaccaga
gagatactggagttcccccccagggatgtctacgtacccaacactacctacaggaaccta
ctgtatgtgaacccacacagcctgaacttcgccaaccgtcaaggctccgcccggaacatc
acagtgaaagtacagtttatgaacggggaggaccccaacaacgctatgcctgtgattttt
gggaagtccagctgtggagactacaccagagaggcatacactgctgtggtgtatcatacc
aggtccccagacttccacgatgaggtgaagatcaagctgccggcctctctgactgaccac
caccacgtcctgttcaccttctaccatgtcagctgccagcagaagcagaacactcctctg
gaaacccctgtaggatacacgtggatccccatgcttcagaatggacgtctgcgtacagga
agcttctgtctgccggtgtctctagagaaacctccccagtcctactctgttctctcccct
gacgttcctctaccagggatgaaatgggtggataaccacagaggggtgttcaatgttgaa
gtgacgtccgtttccaccgtccacacacaggaccagtacctggataagttctttgcgttg
gtgcatgccctggacgagcacatgttccctgtgcggatcggagacgtgcgcatcatggag
aataacctggaggcggagctgaagtccagcatcgcagcactaaactcctcccagctggag
cccatcgtccgattcctccacctcctattggacaagctggtggtgctggtggtgcggccg
cccgtcatcgcaggacagatagtgaatctgggccaggcctcgttcgaggtgatggcctcc
atagtgaatcggctccacaagtacctagacaccagtcaggacatgcacggcagaaacagt
ctgctctcctcttatatatactacgtcttcagactgcccaacatggaccccaacttcccc
tcaccaggtcctggagggctgggtggttcagtccactatgccaccatggccaggtcagcc
cagcgaccagctagcctaaacctcaaccgctcccgtagccttagcaacagtaacccggac
atctccggaacacctacgtcccctgacgacgaggtccgctccatcatcggcagtaaggcc
atggagcgctgtggcaaccgcatgtcttcgcacactgagagcaccagtttcttgcaaact
ttaacaggacgcttacccaccaaaaagttgttccacgaggagctggctctacagtgggtg
gtgagcagtggcagcgtcagggagggagctcttcaacaggcctggttcttcttcgagctc
atggtgaagagcatcatccatcacctgtacttcactgaccggctggagtcgcccaggaag
aatcgtttccccgagcgcttcatggatgacatcacagccctggtcagcaccattgctggg
gacattgtctcacgctttcagaaggacctggagctggtggagcgtcttaacaccagcctg
gccttcttcctgaatgacctgctgtctgtcatggaccgaggcttcgtcttctccctcata
aagacctactggaaacaggtgtccactaagctgtacatgctgcagaaccccactctggag
tctctgagactggacttactgaggatcgtctgcagccacgagcactatgtcacccttaac
ctgccctgcagcctgctcacgccccccgcctcgccttctcccagcgtgtcctccgcaacc
tcgcagagctcaggcttctccacccatgcacaggaccagaagatagccaacatgtttgag
ctgtctgtccccttcagagagcagcactacctggctggactagtgctgtctgagctggct
gtcatcctggacccagaggccgaagggatgtttggcttacataagaaggtggtcagtgtg
gtacataacctgctgtccagccatgactccgacccccgctacgctgaccccgaggtcaag
gcccgcgtcgccatgctctacctgccgctcataggcatcgtcatggaaacacttccccag
cttcacgacttcacagagtcccataaccagtggggtcgtcccggcggggctcagggggcc
acgggtggggccgggggggacgagtctggagaggacggcaacagcatgatcagtcagacc
gttgccatggcaatagcggggacatccgctccgatatctcgtcccagtagcttcctgctc
aacccacaggccagtcgtcagcatggaaccttctcagcagagtccagccgcagcctgttg
atctgtctgttgtgggttctgaagaatgctgatgagtgtgtcctacagaagtggttctct
gacctgtctgtctcccagctcaaccgtttgctggacatgctctacctctgtgtctcctgc
ttcgagtacaaggcccatgttgtgttcaccatgcaggggaagaaggcctttgagcgcatg
aacagcctaaccttcaagaagtccaaggacatgaaggtcaagctggaggaggctatactg
gggagcatcggggcacggcaggagatggtccgtcgcagcaggggacagctaggtacacta
gagaggagtccatcaggcagtgcctttggcagccaggagaacctgcgctggaggaaagac
atgacacactggcgccagaacagcgagaggatggacaaaaccagagcggagctggagcac
gaagcacttattgatggtaacctggcaaccgaggcaaacttgatcattctggacactctg
gagatcatcgttcagacggtgtctgtgacagagtctaaggagagtatcttgggtggagtg
ttgaaggtgctgctccacagcatggcctgtaaccagagtgccctctacctgcagcactgc
tttgctacacagagggctatcgtctcaaagttccctgaactgctgtttgaggaggaaaca
gagcagtgtgctgacctgtgtctgcgtctgctgaggaactgtagcagcagtatcggcacc
atccgagcccacgcctccgcttcactctacctgctcatgaggcagaactttgagatcggc
aacaattttgcacgtgtcaagatgcaggtgaccatgtccctgtcctccctggtgggaacg
tctcagaacttcaacgaggagttcctccgacgttccctgaagaccatcctgacctacgga
gaggaagacctggaactccgggagaccaccttccctgatcaggttcaggacctggtgttc
aacctccacatgatcctgtctgatacagtcaagatgaaggagcatcaggaggacccagag
atgctcatagacctcatgtacaggatcgctaagggttaccagacgtctccagacctgcgt
ctgacgtggctgcagaacatggcgggtaaacactctgagaggaccaatcacgcagaggca
gcccagtgtttggtgcacagcgccgccctggtggcagaatacctcagcatgctggaggac
cgcaagtacctgccggtcggctgtgtcaccttccagaacatctcttccaacgtgcttgag
gagtcagcagtctctgatgatgtggtgtctcctgatgaagagggtatctgctctgggaaa
tacttcactgaggctgggctggtggggctgctggaccaggctgcttcctccttctccatg
gctggtatgtacgaggcggtgaacgaggtgtacaaggtactgatccccattcacgaggcc
agccgggacgccaagaagctggccaccatacatggtaaactacaggaagcctttggcaaa
atcgtacaccaggatgggaagagaatgtttggtacgtacttcagagtcggattgtacggt
tctaaattcggggacttggacgagcaggagtttgtatacaaagagcctgccatcaccaag
ctggctgagatctcacaccgactcgaggggttttatggcgagcgctatggagaagaccag
gtggaagtcattaaggactccaatcctgtggacaagtgcaaacaggacccaaataaggct
tatgtccagatcacatacgtggagccgtacttcgacacatacgagatgaaggaccgcatc
acgtacttcgacaagaactacaacctgcggcgctttgtctactgcacgccgttcacgctg
gacgggcgggcgcacggggatctgcacgatcagttcaaacgcaaaaccatcctgaccaca
tcccacgcctttccctacatcaagacccgcatcaacatcatccacaaagaggagatcatc
tctatgcccatcgaggtggccatagaggatatgcagaagaagaccggagagctggccttc
gctacccaccaggacccatctgatgccaagatgctgcagatggtgctgcaggggtcagtg
ggaactacggtcaaccagggacctctggaggtggcccaggtgttcctgtcagagatcccc
agtgatcctaaactctacagacaccacaacaaactacgcctctgcttcaaagacttcacc
aagaggtgtgaagatgccctgcgtaaaaataagagtctgattggtccagaccagaaggag
taccagagggagttggagaggaactaccatcgcctgaaggaggcactacagccactcatc
tgcagaaagataccccagctttataaacccgtgctgcaggtcaactctcacagagattcc
ttcagcagaatgagtcttcgcaagcttgaactttga

DBGET integrated database retrieval system