KEGG   Salmo salar (Atlantic salmon): 106562804Help
Entry
106562804         CDS       T04363                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106562804
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sasa04131]
    106562804
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:sasa04812]
    106562804
   04147 Exosome [BR:sasa04147]
    106562804
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106562804
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   106562804
Membrane trafficking [BR:sasa04131]
 Others
  Actin-binding proteins
   Others
    106562804
Cytoskeleton proteins [BR:sasa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     106562804
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106562804
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N fn3_2 SusE DUF4251 PhoD_N TusA
Motif
Other DBs
NCBI-GeneID: 106562804
NCBI-ProteinID: XP_013983296
UniProt: A0A1S3KX55
Position
ssa11
AA seq 1957 aa AA seqDB search
MVLTWNRPENDGGSEMDGYIVEKRDKDGVRWTKCNKRRLNDIRFRCTGLTEGHSYEFRVS
AENSAGLGVPSEPTGYIKACDPLYPPGPPYNPRVTDHSTTTVSISWTKPIYDGGAAIKGY
VVEMKEVTEEEWTTCTPPTGVEETHFTVKTLKENREYNFHICAINTEGVGEPADVPGTVV
TSERLEAPEIELDSDLRKMVSVWACATLRLFVPFRGRPDPVVKWSKMEGSLTEHAHIEVT
STYTVLVIHTVNRLDTGKYALTLENIGGMKSAFINVTVLDSPSAPEHVEVKDITGDSVSL
SWEPPLIDGGAKITHYIVEKREAQRRAFTSVSDNCGRNRMKIDNLIQGGLYYFRILAVNE
LGVGLPAETPEPIKVSQAPLPPGKVTVVDVTHDSVSLSWEKPDDNGGSRIKCYVVEMQTK
SDDKCTVCSEIRGLRSTIDGLLTGEEYSFRISAVNETGKSEPKLLAEAVVVNDDTMEPII
DLMCNSFSVKAGDDLKIDVPFRGRPEPEVSWNKDGVELKETTKVSFLTSNNSSKITIRNT
TREESGNYEITLTNTVGRKSAIKAVTILDKPGPPGAIKVDEVNADYISLSWDPPLYDGGC
PISNYVVEKRDTTTTTWKTVSATVARTSIKVPRLTQGTEYQFRIAAENRYGVSRAVESAS
VVAQYPFEVPGPPTTLHVAQATKSFMLVTWNEPANDGGSPIIGYHLEMKDYSSIRWTKTN
RRRLIADTEFKVNGVEESLQYEFRVSAENIAGVGPYSKATEPIAARDPCDPPANLTVTDI
TRTSISLTWSKPENDGGAKVTGYIVERRELPDGCWLKCNFTNLQETCYDIEGLTEDIQYD
FRVIAKNSAGVLSEPSQCTGGITVKDNVVLPRIVLDNKYKKLVIVKAGDVLRIDADISGC
PRPVISWSKDGEKIEVKARLEITSTHTTTTLLVRDTIRRDSGQYTVTVQNIAGTRSLSVN
CKVLDRPGPSTEPLDVTGLTAEKCTLTWGPPQENGGADILHYIVEKCETSRVTWTSIYED
VKATTCKVTSLRKGNEYILRVKAVNEYGEGEALESEPTKATDPFTVPAAPTDVEITSVTS
ETMTICWKRPESDGGSSISGYVIEKREKSGLRWVKVNTKLVNDLRVKASNLCEGCEYEYR
VYAENVAGLSPPSIPCKLTKAEDPQFLPSPPAKPKVIDKTKTSVTLSWNKPLFDGGAAVT
GYCVEYKRTDEEDWCGSVSNTENTEFTVVGLTSGAEYVFVVKSINKIGVSEPSLPTDPQA
AEDREEEPQFNISNEMRKTLLVKDGSSFTLTVPFRGKPVPDVMWDKADVDLRVRASIHTT
DTVTSITVEQATRDDSGKYTVTLQNVAGKVTCTLNVRVLDSPGPPCRVGVKDVTKCSATV
TWDTPENEGGAAVTNYLVDIREVSNKGWTRVTDSCPRLTYRVSDLQEGGVYYFRVTGENQ
YGIGLPAETKYGATITEKPSPPQTIEVTGITKESVSLSWTKPENDGGSRITSYRVDALEK
GQDKWVKCGVTKTVHFVVYDLKEATQYFFRVRAENHAEFSDPTEMALPVLVKGQLEPPEM
NMNKFPDNIVYVRAGSNLKCQIPLTGKPAPKICLSKNDVVLKSTMRFNSEVTPEYLIISL
RESTATDSGRYDICASNTSGASRSFVTIVVLDRPSAPVGPIGMSEVTEDSVSLTWLPPRY
DGGSPITNYIIMKRETRNANWTEVSSVVVKCTMKIMKLITGLEYQFRIRAENRYGISEYI
DSATVKVDLNYTVPEAPSPPIVTSVTRESITVAWTEPNWNGGRPVVGYHLQMKDKNSILW
QTVNKTVIRAAHFKVTNVIVAGLIYEFKVAAENAAGCSPLSKISDAVLAIDACEPPTNVR
ITHIRKSSISLEWLKPSYDGGSKVTGYLIEKKEGERDRWTKVNLTNVSDTHYTVTELNEC
VVYEFRVVAKNAAGSVSNPSVTAGPAMCVDTDDYEED
NT seq 5874 nt NT seq  +upstreamnt  +downstreamnt
atggtccttacatggaatcgaccagaaaacgatggtggttcagaaatggatggctatatc
gttgaaaaacgtgataaagacggtgttagatggacaaagtgtaacaagagaagacttaac
gatatccggttcagatgcaccggactcaccgagggacattcctatgagttcagagtatct
gctgagaattctgctggtctgggagtgccaagtgaaccaacaggatatatcaaagcttgt
gaccctttatatccaccaggtcctccttacaaccctagggtgacagaccattcaaccaca
accgtgtctatctcatggacaaaacccatctatgatggtggagcagccatcaaaggatac
gttgttgagatgaaggaagtaacggaggaagagtggacaacttgtacaccaccaactggt
gtagaagaaacacacttcactgtgaaaacactgaaggaaaatcgagaatataacttccac
atctgtgcgattaacactgaaggagttggggaaccagctgatgtcccagggactgtagtt
acatccgaaagacttgaggcccctgagattgaactagattcagaccttaggaaaatggtg
tcagtttgggcgtgtgcaacactacgtctatttgtcccattcagaggaagacctgatcct
gtagtcaagtggtccaagatggaaggatctcttactgagcatgcacacattgaggtcaca
agcacctacacagtccttgtcatccacactgtcaacagacttgacactggcaagtatgcc
ttgactcttgagaacatcggcggtatgaagtctgctttcattaatgtcacagtgttggat
tcaccaagtgcccctgagcacgttgaagtcaaggacatcaccggagattctgtatcacta
tcctgggagcctccactgattgacggcggagctaagatcacacattacattgtggagaag
agagaagctcaaagacgggcttttaccagtgtttcagataactgtggaagaaatagaatg
aagatcgacaaccttatacaagggggactttactatttccgcatactagcagttaatgag
ctcggtgtgggtttgccagcagaaacaccagaaccaatcaaggtatcacaagctcctttg
cctcctggtaaagttaccgttgtagatgttactcacgacagcgtgagtctgtcatgggaa
aagcctgacgataacggtggtagcagaatcaaatgctacgtagtggaaatgcaaaccaag
agcgatgacaaatgcactgtgtgttctgagataaggggattgagatcaactattgatggg
ctcttaacaggtgaggaatattcatttaggattagtgcagtcaatgaaacaggcaagagt
gaacctaagctactggcagaggctgtcgtagtaaacgacgacacaatggaacctatcata
gatctaatgtgcaactcattcagtgtcaaggcgggagacgatctgaaaatcgatgttcca
tttagaggcagacctgaacctgaggtttcatggaacaaagatggtgttgaattgaaggag
acaaccaaggttagctttcttacatctaataactcatcaaaaatcactatcagaaacaca
acgcgggaggaatcggggaactatgagatcaccttaaccaacacagttggtagaaaatca
gccataaaagctgttaccatcttggataaaccaggcccacctggtgcaatcaaggtagat
gaagtcaacgctgactatatttcactgtcttgggatcccccactctacgatggaggatgt
ccaatcagcaactacgtagtagagaagagagatactaccactacaacatggaagactgtt
tcagccacagttgccagaacatctattaaagttcctcgtttgacacaaggcactgaatat
cagttccgtattgcagctgaaaaccgctacggcgttagccgtgctgtggagtccgcttca
gttgttgcacagtaccccttcgaggtacctggtcctcccactaccctccatgttgctcaa
gctacaaagtccttcatgttggttacatggaatgaaccggccaatgacggtggaagtcca
atcatcggttatcacctggaaatgaaggactatagcagtattcgctggacaaagactaac
agaagacgtctcattgctgatacagaatttaaagtgaatggcgttgaagaaagcttgcag
tatgaattccgtgtttctgctgagaatatcgctggcgttggaccgtacagcaaagccact
gagcctatagctgcgagagatccatgtgatcctcctgctaaccttacagttacggacatc
acaagaacttccatttctcttacttggtccaagccggagaatgacggtggagccaaggtg
actggctacattgttgaacgcagggaacttccagatggttgttggttgaagtgcaatttc
accaatctccaggaaacttgctatgacattgaaggccttacggaggatattcaatatgac
ttccgtgttattgcaaagaactctgctggagtactcagtgagccatcacaatgtacaggt
ggcatcacagtcaaggataacgtggttctacctcgtattgtcttggataacaagtataag
aaattagtcattgtcaaagctggagatgttctgagaatcgatgcagatatttctgggtgc
ccacgtccagtcatttcatggtcaaaggatggtgaaaaaattgaggtcaaggcaagacta
gagatcacttcaacacacactaccaccacattactagtcagagacactattcgaagagac
tcgggtcaatacactgtaacagtgcagaacattgctggtacaagatccctgtctgtaaac
tgtaaggttctcgaccgccctggaccatccactgagccattggatgtgactggtctgacc
gcagagaaatgcactttgacctggggaccacctcaagaaaatggtggtgcagatattctg
cactatatagttgagaaatgtgaaaccagtcgtgtcacctggacttcaatatatgaagac
gtgaaggctacaacatgcaaggtcaccagtctgcgtaaaggaaatgaatacatcttaaga
gtaaaggcagtgaatgaatatggagaaggtgaagccttggagagtgagccaaccaaagcc
acagatccattcactgtccccgctgcaccaacagatgttgaaatcaccagtgtaacaagt
gagacgatgacaatctgctggaaaagacctgagtccgatggaggaagcagcatttctggt
tatgttattgaaaaacgagagaaatctggattgcgctgggtaaaggtgaacacaaagctt
gtgaatgaccttagggtcaaggcatccaatctctgtgagggatgtgagtatgagtacaga
gtctatgcagaaaatgttgcaggcttgagtcccccaagtattccttgcaaactgacaaaa
gcggaggatccacaattcctgccatcaccaccagctaaacccaaagtcattgacaaaacc
aagacttctgtaactctttcatggaataagccattgtttgatgggggagctgctgtaaca
ggatactgtgttgaatataagagaacagatgaagaggactggtgcggcagtgtttcaaac
acagagaacactgaattcactgtcgttggattgacatctggagcagaatatgtatttgtt
gtcaaatccatcaacaagattggtgtcagtgagccaagccttcctactgatccacaagca
gctgaggacagagaagaggaaccacagtttaatatcagcaatgagatgcgaaagactctt
cttgtaaaggacggcagttcattcaccttaactgtgccattcaggggcaagcctgttcct
gacgttatgtgggacaaggcagatgttgacctgagagtgagggccagtattcataccact
gataccgtcacgtctatcacagtggaacaagcaacaagagatgactctggaaaatataca
gtgactttacaaaacgttgctggaaaagtcacatgtacattaaatgtcagggttcttgac
tctcctggtccaccatgccgtgttggggtcaaggacgttaccaagtgctctgcaacagtc
acctgggataccccagaaaacgaaggtggtgctgctgtcaccaactaccttgttgatatt
cgtgaggtgagcaacaagggatggaccagagtcacagattcatgtcctcgtctgacctac
agagtgtcagacctacaagagggaggagtgtactacttcagagtcactggtgaaaaccag
tatggaatcggcttgccagctgagaccaaatacggagcaacgattacagaaaaacccagc
ccaccacaaaccatcgaagtcaccgggatcaccaaggaaagtgtgtccctgtcatggacc
aaacctgagaatgacggaggtagcagaatcaccagttatcgagtcgatgctctcgagaag
ggtcaggataaatgggtgaagtgtggcgtcaccaagaccgtccactttgtggtgtacgac
ctgaaggaagctactcagtactttttcagagttcgtgctgaaaaccacgctgaattcagt
gaccctacagaaatggctctccctgtgttagttaaagggcaacttgaacctcctgagatg
aacatgaacaagttccctgacaatatagtctacgtcagagcaggatcaaacctgaaatgc
caaatcccacttactgggaaacctgcgccaaagatttgtctttcaaagaacgatgttgtg
ttgaagtcaacgatgagattcaactctgaagtaactcctgaatatcttatcatcagtctt
cgtgagagcaccgctactgattcaggaaggtacgacatatgtgcctccaacaccagcgga
gcttccaggtcttttgtgaccattgtggtcctggatagacccagcgccccagttggtcct
attggaatgtctgaagtgacagaggacagtgtgagtctgacttggcttcctcctcgttat
gacggcggaagccccatcacaaactacataataatgaaacgagaaacgagaaacgccaac
tggactgaagtctcctcagtcgttgtgaaatgcacaatgaaaatcatgaagctcataaca
ggactggagtaccagttcagaatcagggctgaaaatcgctacggcatcagtgagtacatc
gactctgcaaccgtcaaagtggatcttaactacaccgttcccgaagctccgtcacctccg
atcgttacgtctgtaaccagagaaagcatcaccgtcgcctggacggagccgaactggaac
ggaggaagaccagtagttggatatcatcttcagatgaaggacaagaacagcatcctgtgg
cagacggttaacaaaaccgttatccgcgccgcacacttcaaagtgacaaacgtcatcgtc
gctggtctcatctacgagttcaaggtggcagcagaaaacgcagctggatgcagtcccctt
agcaagatctcagacgctgtactggcgattgatgcttgtgagcctccaaccaacgtccgg
atcactcacatcagaaagtcttccatcagccttgagtggttgaagccttcttacgatggt
ggtagcaaggtcacaggttacctgattgagaagaaagagggcgaaagagacagatggacg
aaggtcaacttaaccaacgtttctgacacacactatacggtgacagagctgaacgagtgt
gtggtttatgaattcagagtcgtggcaaagaatgcagctggatcggtcagcaatccgtcc
gtcactgccggcccggcgatgtgtgtggacacggacgattacgaagaagattag

DBGET integrated database retrieval system