KEGG   Salmo salar (Atlantic salmon): 106563760Help
Entry
106563760         CDS       T04363                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04012  ErbB signaling pathway
sasa04068  FoxO signaling pathway
sasa04137  Mitophagy - animal
sasa04140  Autophagy - animal
sasa04141  Protein processing in endoplasmic reticulum
sasa04210  Apoptosis
sasa04217  Necroptosis
sasa04310  Wnt signaling pathway
sasa04510  Focal adhesion
sasa04530  Tight junction
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04910  Insulin signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04920  Adipocytokine signaling pathway
sasa04933  AGE-RAGE signaling pathway in diabetic complications
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106563760
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106563760
   04012 ErbB signaling pathway
    106563760
   04310 Wnt signaling pathway
    106563760
   04068 FoxO signaling pathway
    106563760
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106563760
   04137 Mitophagy - animal
    106563760
  09143 Cell growth and death
   04210 Apoptosis
    106563760
   04217 Necroptosis
    106563760
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106563760
   04530 Tight junction
    106563760
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106563760
   04621 NOD-like receptor signaling pathway
    106563760
   04622 RIG-I-like receptor signaling pathway
    106563760
   04625 C-type lectin receptor signaling pathway
    106563760
  09152 Endocrine system
   04910 Insulin signaling pathway
    106563760
   04920 Adipocytokine signaling pathway
    106563760
   04912 GnRH signaling pathway
    106563760
   04914 Progesterone-mediated oocyte maturation
    106563760
  09158 Development and regeneration
   04361 Axon regeneration
    106563760
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106563760
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106563760
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106563760
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106563760
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106563760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Kinase-like DUF1635
Motif
Other DBs
NCBI-GeneID: 106563760
NCBI-ProteinID: XP_013985080
UniProt: A0A1S3L2P4
Position
ssa11
AA seq 421 aa AA seqDB search
MSEGEGLFHSVQVGDSTFTVLTRYQQLRAIGSGAQGIVCSALDSVLGVPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIRLLNVFTPQNSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEVLG
TPPMEFMNRLMETVRNYVMNKPQYPGVSFSQLFPDWAFPAETEQDQLKTSQARDLLSKML
VIDPESRISVEDALDHPYIHMWYDPGEADAPPPQISDKQLEEREHSIEQWKELIYDELMD
WEERNQNGVMKENCADEVANHSATASQSSSTSDFSSMSTEQTLASDTDSSCVDTLTGALE
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagggggaggggctcttccacagcgtgcaggtgggtgactccaccttcactgtg
ctgacccgctatcagcagctccgcgccatcgggtctggtgcccagggcattgtctgctcg
gccctggacagtgtccttggggtccctgtggcggtgaagaaactgagccggcccttccag
aaccagacccacgccaagcgggcctatagggagttggtgctgctcaagtgcgtcaatcac
aaaaatattattaggctcctgaatgtcttcacaccacagaattcactggaggagttccag
gatctttacctggtgatggagctgatggatgccagtctgtgccaggtcatccacatggat
ctggaccatgagaggatgtcctacctgctctaccagatcctctgtggcatcagacacctg
cactccgctggcatcatccacagggacctgaagcccagtaacatagtggtgaagtctgac
tgtactctgaagatcctggactttgggctggccagaacagcctgcactaacttcatgatg
accccttacgttgtgacccgatactacagagcaccagaggtcatcctgggcatgaagtat
aaagagaatgtggacatctggtcagtgggatgcatcatgggagagatggtgaagggcagc
gttatattccagggcacggatcacattgaccagtggaacaaggtgattgaggttctgggc
acgccccccatggagtttatgaaccgtttgatggagactgtgaggaactatgtgatgaac
aagccccagtacccaggggtcagcttctctcaactcttccctgactgggccttcccagca
gaaacagagcaggatcaactcaagaccagtcaagcacgggacctcctttccaagatgctg
gtgattgacccagagagccgtatttcagtggaggatgccctggatcacccctacatccac
atgtggtacgacccaggagaggctgatgcgccaccaccacagatatctgataaacaactg
gaggagcgagaacacagcattgaacagtggaaagagctgatctatgacgagttgatggac
tgggaggagaggaaccagaatggagtaatgaaggagaactgtgcagatgaagtggcgaac
cacagtgctacagcatcccagtcgtcctctacgagtgacttctcctcaatgtccactgag
cagaccttggcctctgacaccgacagcagctgtgttgacaccctcacgggggcgctagag
gagtga

DBGET integrated database retrieval system