KEGG   Salmo salar (Atlantic salmon): 106565530Help
Entry
106565530         CDS       T04363                                 

Definition
(RefSeq) activin receptor type-1B-like
  KO
K13567  activin receptor type-1B [EC:2.7.11.30]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04060  Cytokine-cytokine receptor interaction
sasa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    106565530
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106565530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106565530
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     106565530
Protein kinases [BR:sasa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   106565530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2 Haspin_kinase Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 106565530
NCBI-ProteinID: XP_013988242
UniProt: A0A1S3LBA2
Position
ssa12
AA seq 513 aa AA seqDB search
MQCNGNIAIMAKNLILLIILVLVCIFGTYDALWCNCTTAQCEKTGSRCETDGACMASTSF
INGLEQHIRICITRDNLVPPGQPFYCLSAEGLLYTHCCYTNYCNSLDLKVTSVTSRPGLG
GVFGPDGKWGPVELVAVVAGPVCLLCVLLIMAVFLFQYHQRAYSHRQRLEVEDPSCDHLY
MAKDKTLQDLIYDMSTSGSGSGLPLFVQRTVARTIVLQEIIGKGRFGEVWRGRWRGGDVA
VKIFSSREERSWFREAEIYQTIMLRHENILGFIAADNKDNGTWTQLWLVSDYHEYGSLFD
YLNRYAITIEGMIKLALSAASGLAHLHMEILGTQGKPGIAHRDLKSKNILVKKNSTCAIA
DLGLAVRHESTTDTIDIAPNQRVGTKRYMAPEVLDESINMRHFDSFKCADIYALGLVYWE
IARRCNAGGIHEEYQLPYFDLVPSDPSIEEMRKLVCDQKLRPNVPNWWQSYETLRVMGKI
MRECWYANGAARLTALRIKKTLSQLSVQEDIKV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcaatgggaatatagcgatcatggctaagaatctaattttgttaattattctc
gtcctggtttgcatattcggaacttatgatgctttgtggtgtaactgcaccacagcccag
tgtgagaagactggctcccggtgtgagacagacggggcctgcatggcctccacgtccttc
atcaatgggctggagcagcacatccgtatctgcatcacccgggacaacctggtgcccccg
ggccagcccttctactgcctgagtgctgagggcctcctctacacacactgctgctacact
aactactgcaacagcctcgacctcaaagtaacttctgtgacatcgcggccgggcctgggg
ggcgtctttggccctgatggtaaatggggtccagtggagctggtagcagtggtcgcaggg
cccgtctgcctgctgtgtgtgctgctaatcatggctgtgttcctgttccagtaccaccag
agggcctacagccacaggcagaggctggaggtggaggacccctcctgtgatcacctctac
atggccaaggacaagaccctgcaggacctcatctacgacatgtccacctctggatcaggc
tccggcctccctctgtttgtccagcgaacagtggccaggaccatcgtgctgcaggagatt
atagggaaagggcgtttcggggaagtgtggcgcggccgctggagaggaggagacgtggca
gtgaagatcttttcgtccagagaggaacgctcctggttccgcgaggccgagatctaccag
accatcatgctgcgccacgaaaacatcctgggattcatcgccgccgacaacaaagataat
ggcacatggacccagctgtggctggtgtcagactaccacgagtacggctctctgtttgac
tacctgaaccgctacgccatcaccatcgagggaatgatcaaactggcactgtctgctgcc
agcgggctggcacacctgcacatggagatcctgggcacacagggtaagcctggtattgcc
caccgggacctcaagtctaagaacatcctggtgaagaaaaacagtacctgtgccattgct
gacctggggctggccgtgcgccacgagtccaccaccgacaccatagacatcgcccccaac
cagagagtgggcacaaagaggtacatggcccctgaggttctggatgagagcatcaacatg
aggcattttgattcatttaagtgtgcagacatctacgctctgggcctggtttactgggag
atcgcacgccgctgcaacgctggaggtatccatgaggagtaccagctaccatactttgac
ctggtgccctctgacccctccatagaagagatgaggaagctggtgtgtgaccagaagcta
cggcccaacgtgcccaactggtggcagagctacgagaccctgcgtgtgatggggaagatt
atgagggagtgttggtacgccaacggagccgcccgcctcaccgccctgcgcatcaagaag
accctgtcccagctgagtgtccaggaggacatcaaagtttga

DBGET integrated database retrieval system