KEGG   Salmo salar (Atlantic salmon): 106566135Help
Entry
106566135         CDS       T04363                                 

Gene name
mars
Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00450  Selenocompound metabolism
sasa00970  Aminoacyl-tRNA biosynthesis
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106566135 (mars)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106566135 (mars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sasa01007]
    106566135 (mars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sasa03016]
    106566135 (mars)
Enzymes [BR:sasa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106566135 (mars)
Amino acid related enzymes [BR:sasa01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106566135 (mars)
Transfer RNA biogenesis [BR:sasa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106566135 (mars)
 Prokaryotic type
   Other AARSs
    106566135 (mars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g GST_N_5 WHEP-TRS tRNA-synt_1 Anticodon_1 tRNA-synt_1e GST_N_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 106566135
NCBI-ProteinID: XP_013989462
UniProt: A0A1S3LES7
Position
ssa12
AA seq 1021 aa AA seqDB search
MKLFVSDGNPHCVKVLAVLEFTGVKCDVKHVNHEERVVPYLSRPALPALLLPSGTYLFSP
NSICQYLIEVNGQESSDIVNQWLEWEATELQPAVMQALHMVVLQGKGAQTTRVLQGPLSY
LDQSLSKRTTLFLTAEMVSVADVVLWAALYPILSDSSLVSGNQTELQHWFERVGMLAACG
SAAQTALHGKGLKAESLKTYLQRQPSTHHGQGQVQGRGSQPCNSPEGDDDGDCVLSEEEI
QSFAVTWGKGLADLPMVPERQHPILPVEGKRNVLVTSALPYVNNVPHLGNIIGCVLSADV
FARYGRLRGWNVLYVCGTDEYGTATENKAREEGLTAQQICDKYHAVHASIYQWFQVDFDF
FGRTTTKKQTEIAQNIFWRLHERGFLLEDIVEQLRCEACQRFLADRFVEGTCPYCSYPEA
RGDQCDKCGKLINAVELREPTCKVCSQTPVVQSSKHLFLDLPKLEAELEQWLEKSTGSGD
WTANAKQITRSWVRDGLKPRCITRDLKWGTPVPHPDFSDKVFYVWFDAPIGYLSITANYT
DQWEMWWKNPQQVELYNFMAKDNVPFHSVVFPCSLLGAQDNYTLVNHLVATEYLNYEDTK
FSKSRGVGVFGDMAKDTGIPSDVWRFYLLYLRPEGQDSAFSWVDMATKNNSELLNNLGNF
INRAGMFVSKFFESYVPAMDLQQEDKRLLAQVGWELKQYMNLMDRVKIRDALKCILNISR
HGNQYIQVNEPWKKIKGDETDRQRSGTVTGVSVNVACLLSVMLQPYMPTVSQTICQQLNA
PPTVTGTMLQGTGNFVCSLPAGHHIGTVSPLFQKLEAEQIESLKKRFGGQQPEEEEEEAK
PKKPKTAAQTDVNAQPAPSPASHPAAQTAVNGADAERARELTLAVAEQGEKVRTLKGQKA
EKAVIGAEVTKLLELKKQLSLAEGKHPEPVLIKGKKNAQPAPSPASHPAAQTAVNGADAE
RARELTLAVAEQGEKVRTLKGQKAEKAVIGAEVTKLLELKKQLSLAEGKHPEPVLIKGKK
K
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattcgtgagtgacggaaatccgcactgtgttaaagtgctagcagtcctcgaa
tttactggagtcaaatgtgacgttaaacatgtcaaccacgaagagagagtggtgccctac
ctcagccgtccagccctgcctgctctgctcctccccagtggaacatacctcttcagcccc
aactccatctgccaatacctgatagaggtgaatggacaggaatccagtgatatcgtcaac
cagtggctggaatgggaagctacagaactacagcctgcagtgatgcaggcccttcacatg
gtggtgctgcagggaaaaggagcacaaaccaccagggttctacagggacctctcagctac
ctggaccagagcctgagcaagaggaccacgttgttcctcactgctgagatggtttcagtg
gcagacgttgttctgtgggcagctctctaccccatcctgtctgacagcagtctggtatca
ggtaatcagacggagctgcagcactggtttgagcgtgtgggcatgttggcagcctgtggc
tctgcagcccagactgcactgcacgggaagggactgaaggctgagtctctgaagacctac
ctgcagagacagccatccacacaccatggtcagggacaggttcagggtagaggctcacag
ccatgcaacagccctgagggtgatgacgatggtgattgtgtgctgtcagaggaagagatc
cagtcttttgcggtcacctggggtaaaggacttgcagacttacccatggttccagagaga
caacaccctattcttcctgtggagggcaagaggaacgtcctagtgaccagtgccttgcct
tatgttaacaacgtccctcatctgggcaacatcatcggctgtgtgctcagcgctgacgtc
ttcgccaggtatggtcgtctgcgtggatggaatgtactgtatgtgtgtgggactgatgag
tacggtacagctacagaaaacaaggcccgtgaggaaggtctaacagcgcagcagatctgt
gataagtaccatgctgtccacgcctccatctaccagtggttccaggtggacttcgacttc
tttggccgcaccaccacaaagaaacagactgagatagcccagaacatcttctggcgtctc
catgagcgaggtttcctacttgaagacattgtggagcagctgcgctgcgaggcgtgccag
cgttttctagccgaccgcttcgtggagggaacatgtccctactgctcttacccagaggcc
cgaggggaccagtgtgacaagtgtggcaagcttatcaacgctgtggagctacgggagcct
acttgtaaggtgtgtagtcagactcctgtagtccaatcctccaaacacctgttcctggac
ctgcccaagttggaggctgagttggagcagtggttggagaaatctactgggtcaggagac
tggacggccaacgccaaacagatcaccaggtcctgggtgagggacggactcaaaccccgc
tgcatcaccagagacctgaagtggggaacccctgtacctcaccccgacttctctgacaag
gtgttctacgtgtggtttgacgctcctattggttacctgtccatcacagccaactacact
gaccaatgggagatgtggtggaagaacccacaacaggtggagctgtataacttcatggcc
aaggacaacgttccgttccatagtgtggtgttcccctgctctctactgggagcacaggac
aactatacactggtgaaccacctggtggctacagagtacctcaactacgaggacaccaag
ttctccaagagtcgaggtgttggtgtgtttggtgacatggccaaggatacgggcatcccc
tctgacgtgtggagattctacctgctctacctccgtcctgagggacaggactcggccttc
tcctgggtggacatggccaccaagaacaactctgagcttctcaacaacctgggcaacttc
atcaacagggctggtatgtttgtcagtaagttctttgagagctatgtccctgccatggat
cttcagcaggaggacaagaggctgttggctcaggtgggatgggagctgaagcagtacatg
aacctcatggacagagtcaagatccgtgatgccctgaagtgtatcctcaacatctctcgc
cacggtaaccagtacatccaggtcaacgaaccctggaagaaaatcaaaggagacgaaaca
gacaggcagcgatcgggtacagtgacaggtgtgtctgtgaatgtggcgtgcctgctgtcc
gtcatgctccagccctacatgccaacggtcagtcagaccatctgccagcagctgaacgcc
ccgcccaccgttaccggcaccatgctgcagggcacagggaacttcgtctgctctctgccc
gccgggcatcacattggcacggtcagcccgttgttccagaaactagaggctgaacagatc
gagtctctgaagaagaggtttggaggacagcagccagaggaggaggaagaagaagccaaa
ccgaagaagccgaagacggcagcccagactgatgtcaacgctcagcccgctccaagccca
gcttcacatcctgctgctcagactgcagtgaacggtgctgacgctgagagagccagagag
ttaacactggctgtggcagaacagggggagaaggtccggaccctgaagggccagaaggca
gagaaagctgtgattggagcagaggtcaccaaactactggaactgaagaaacagctctcc
ctggctgagggaaaacacccagaaccagtgttgataaaaggcaagaagaacgctcagccc
gctccaagcccagcttcacatcctgctgctcagactgcagtgaacggtgctgacgctgag
agagccagagagttaacactggctgtggcagaacagggggagaaggtccggaccctgaag
ggccagaaggcagagaaagctgtgattggagcagaggtcaccaaactactggaactgaag
aaacagctctccctggctgagggaaaacacccagaaccagtgttgataaaaggcaagaag
aagtga

DBGET integrated database retrieval system