KEGG   Salmo salar (Atlantic salmon): 106566157
Entry
106566157         CDS       T04363                                 

Definition
(RefSeq) retinol dehydrogenase 7-like
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    106566157
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     106566157
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 Phage_rep_O
Other DBs
NCBI-GeneID: 106566157
NCBI-ProteinID: XP_013989490
UniProt: A0A1S3LF87
Position
ssa12
AA seq 344 aa
MDSVYQYLGYPAQANDDSGTSSRDNLWLYGVGTFVVLWTLGWLYRDSLEIEDIKEKYVFV
TGCDSGFGNLLCKRLDRLGFRVIAGCLTEKGADDLKRATGPYLKTVLLDVTSTGSIQKAM
EYTKQEVEDNGLWGIVNNAGRSLPMGPSEWMRLEDYTSTLKVNMTGVIEMTLTFLPLIKQ
AQGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDIHYFGIKVCIIEPGFFKTAVT
SLDPIESELHRLWNQLTPEVKASYGDKYLDKYIQIQRLIMNAVCDSDLSKVTNCMEHALT
SAYPRTRYSAGWDAKFGWIPLSYMPSCVIDIGLKLVMPRPAKSV
NT seq 1035 nt   +upstreamnt  +downstreamnt
atggattccgtgtaccagtatttaggatatccagcacaagccaacgacgattcagggact
tcaagcagggataatctatggctgtacggcgtgggtaccttcgtggttctgtggacgcta
ggctggctgtacagagacagtctggagatcgaggatatcaaggagaagtatgtgtttgta
acggggtgtgactctggctttgggaacttgctctgtaaaaggctggaccggctggggttc
agagtgatagctgggtgtctgacagagaaaggggctgatgatctgaagagggcgactggg
ccgtacctgaagacggttctcctagacgtgacgagcaccggaagtatacagaaagccatg
gagtacaccaagcaagaagttgaagataacggactgtggggcatcgtgaacaatgcgggg
cgctccctgcccatgggtccctcagagtggatgaggttggaggactataccagtaccctg
aaggtcaacatgacgggggtgatagagatgaccctcaccttcctgcccctcatcaagcag
gcccaggggaggattgttaatgtagcatcagtactgggtagagtggcagctaacggtggt
ggatactgcatctctaagtttgctgtggagtctttctcagactgcctcaggagggatatc
cactactttgggatcaaggtgtgcatcattgaaccaggtttctttaagacagctgtaacc
agtctggatcccatcgagagtgagctgcatcgcctgtggaaccagctcacacctgaagta
aaggccagctatggagacaaatacctggataagtacatccagatccaacggttgatcatg
aacgcagtgtgtgactcggacctgagtaaagtgactaactgcatggagcacgccttgacg
tctgcctacccccgtacccgctacagtgccggctgggatgctaaattcggatggatcccc
ctctcttacatgccgtcctgcgtcatcgatattgggctgaaactggtgatgccacgtcct
gctaagagtgtctag

DBGET integrated database retrieval system