KEGG   Salmo salar (Atlantic salmon): 106566433Help
Entry
106566433         CDS       T04363                                 

Definition
(RefSeq) glycogen [starch] synthase, liver-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00500  Starch and sucrose metabolism
sasa01100  Metabolic pathways
sasa04910  Insulin signaling pathway
Module
sasa_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106566433
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106566433
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    106566433
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106566433
Glycosyltransferases [BR:sasa01003]
 Polysaccharide
  Storage polysaccharide
   106566433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 106566433
NCBI-ProteinID: XP_013989940
UniProt: A0A1S3LGI4
Position
ssa13
AA seq 703 aa AA seqDB search
MPLTRSLSMTSLSGLPLWDEEDLPVDDLLLFEVAWEVTNKVGGIYTVIQTKAKITVDEWG
ENLFMMGPYYEHNFNTQVEQCEPPNPAIKKAMGALNDNGCLVYFGRWLIEGSPYVILFDT
GSAAWNLDRWKGDLWDTCGIGLPAHDREANDSLIFGSMVAWFFKELTDELGDSPNVLAHF
HEWQVGAGLILCRSRKIPLATIFTTHATLLGRYICAGNVDFYNNLGKFNIDQEAGERQIY
HRYCLERAAVHCAHVFTTVSQITAVEANHMLHRKPDVVTPNGLNIKKFSAMHEFQNLHST
NKGRIQEFIRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGVDIFLESLSRLNYLLRVHKND
VTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHTVKDKFGKRLYEALLKGDIPDMNTI
LDRDDFTIMKRAIYATQRHTLPPVTTHNMLDDTSDPILANVRRIGLFNARIDRVKIVFHP
EFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFME
EHVSDPTAYGIYIVDRRFRSADDSCNQLTQFMFGFCQQSRRQRIIQRNRTERLSDLLDWR
YLGRFYMHARSLALSRAFPDKFKMEPLAPPQTEGFRYPRPGSVPPSPSVSVHSTPHHSDE
EDDDEEPYDEDKEAERDRQNIKAPFTLGATPEGKKTHPGESAN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcccctgacccgttccttatccatgacgtcactgagcggtttgcctctgtgggatgag
gaagatctacctgtagacgacctgctgctgtttgaggtagcctgggaggtcactaataaa
gtgggtgggatctacacagttatccagaccaaggccaagataacagtggatgaatggggg
gagaacttattcatgatggggccgtactacgaacacaactttaacacccaggtggagcag
tgtgagccccccaacccagccatcaagaaagccatgggtgccctcaatgacaacggctgc
ctggtgtactttgggcgctggctgatcgagggcagtccctatgtgatcctatttgacacg
gggtcagcagcctggaacctggaccgatggaagggggatctgtgggacacttgtggtatc
ggcctgcccgcccatgacagagaggccaacgactcactcatcttcggatccatggttgcc
tggttctttaaagagttaaccgacgagcttggagactcgcccaatgtcctcgcccatttc
catgagtggcaggtaggggcaggacttattctctgtcgctcacggaagattcccttggca
accattttcacaacccatgccactctgttgggaagatacatctgtgccggaaatgttgac
ttctacaacaacctgggcaagttcaacatagaccaggaggctggtgagaggcagatctac
catcgctactgtctggagagagctgctgtccactgtgcccatgtctttacaactgtatcc
cagatcactgctgtagaggctaaccacatgctgcacaggaaaccagatgtggtgactcca
aacggattgaacatcaagaagttctcagccatgcacgagttccagaaccttcattccact
aataagggccggattcaggaattcatcaggggacacttctatggtcatctggacttcaat
ctggagaaaactctcttcttctttattgctggacgatatgagttctccaacaagggagtt
gacatcttcctggagtcactgtccagactcaactatctgctaagggtgcataagaatgac
gtcacagtggtggtgttcttcatcatgccagccaagaccaacaactttaacgtggagacg
ctgaagggtcaggcggtacgcaaacagctctgggacactgctcacactgtgaaagataag
tttggcaagaggctttatgaggctttgttaaaaggagacatccctgatatgaacaccatc
ctggacagagacgacttcaccatcatgaagagagccatctatgccacacagagacacacc
cttcctccagtgaccactcacaacatgctggatgacacctcggaccccatcctggccaac
gtgagacgcatcggcctcttcaacgctcgcattgaccgagtcaagatagtgttccaccca
gagttcctgtcgtccaccagtcccctgcttcctatggactatgaggagtttgtacgaggc
tgtcacctgggggtcttcccttcttactacgagccctggggatacacaccaggtgagtgt
actgtgatgggaatacccagtgtgaccaccaacctgtctggcttcggctgcttcatggag
gaacatgtgtcagaccctacagcatacgggatctacatagtggaccggcggttccgctcg
gcagatgactcgtgtaaccagctgacccagttcatgttcgggttctgccagcagtccaga
cgacagcgcatcatccagaggaaccgcacagagagactgtcggacctgctggactggagg
tacctgggacggttctacatgcacgcccggagcctggctctcagcagggctttccctgac
aagttcaagatggagccgctggccccgccacagacagagggattccgttacccccgcccc
ggctctgtgcccccctccccctcggtgtcagtgcactccaccccccaccacagcgatgag
gaggatgatgatgaagagccgtatgatgaagataaggaggcggagagggacaggcagaac
atcaaagccccattcactctgggtgccacgcccgagggcaagaagacacacccaggggag
tctgccaactga

DBGET integrated database retrieval system