KEGG   Salmo salar (Atlantic salmon): 106566659Help
Entry
106566659         CDS       T04363                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:sasa01002]
    106566659
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106566659
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S33
   106566659
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Lipase DUF1057 Thioesterase Abhydrolase_3
Motif
Other DBs
NCBI-GeneID: 106566659
NCBI-ProteinID: XP_013990372
UniProt: A0A1S3LHF6
Position
ssa13
AA seq 350 aa AA seqDB search
MSHNKALKTFLFLLKGKSKIETVKKQNTHLSLHVAERDSERKRNSIYQFLNRYWRRTLGL
QVRYADCGGYRFCYSYRGKPGFRPSILMLHGFSAHKDTWLTMVKYLPKHLHILCVDMPGH
EGTTRTNSEDYSIQGQVKRIHQFVENVRLNRKPFHLVGTSMGGNVAGVYAASFPSEICSI
TLICPAGIRYPCETKFDNHLQDLEHSHYTLSIPLIPSTPEEMEDMLRLCSHVRFKIPQQI
LQGLVDVRLPHNDFYQEVFMEILGENSRYALQENLQLITAPLQVIWGKQDQVVDVSGAVV
VAEALPGCRVDLLENCGHSVVMERPRRTAKLIMEFIISLGTTSGTIKKRS
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtcataacaaagctctaaagacattcttgttcttgctaaaagggaaatccaaaata
gaaacagtaaaaaagcagaacactcatctttctctacatgttgcagagagagactcagag
agaaagagaaacagtatttatcaattcctcaataggtactggaggaggaccctgggtcta
caggtgcgctacgcagactgtggggggtaccgcttctgttactcttacagagggaagcca
gggttcagaccatccatcctcatgttacatggtttctctgctcacaaagacacatggctc
actatggtcaagtatctacccaaacacctgcacatactgtgcgtggatatgcctggccat
gagggaaccactcgtaccaactcagaggactactccatccagggccaggtcaagaggatt
catcagtttgtggagaacgttcgactgaacaggaagcccttccatctggtcgggacctcc
atggggggcaatgtggcaggggtgtacgcagccagcttcccctccgaaatctgtagcatc
acccttatctgtccagcaggtatacggtacccctgtgagacaaaatttgacaatcatctg
caggaccttgagcacagccattacactctgagcatcccactgattccgtccacaccagag
gagatggaggatatgctcaggctttgctcccatgtccgctttaagatccctcaacagatt
cttcaaggactggtggatgttcggcttccgcacaatgatttttatcaagaagttttcatg
gagatattgggtgagaactccagatacgccctacaggaaaatttgcagctgatcactgcc
cctttgcaagtaatttggggcaaacaggaccaggtggtggatgtctctggagctgtggta
gtggcggaggccttgcccggttgcagggtggacctgttagagaactgtggtcactctgtg
gtgatggagaggcctcgccggacggccaaactcatcatggagtttattatctccctgggt
accaccagtggaaccattaagaagcgctcctga

DBGET integrated database retrieval system