KEGG   Salmo salar (Atlantic salmon): 106567228Help
Entry
106567228         CDS       T04363                                 

Gene name
FKB1A, FKB1B
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1A-like
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sasa03110]
    106567228 (FKB1A)
Enzymes [BR:sasa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106567228 (FKB1A)
Chaperones and folding catalysts [BR:sasa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    106567228 (FKB1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 106567228
NCBI-ProteinID: XP_013991742
UniProt: B9ELK2
Position
ssa13
AA seq 108 aa AA seqDB search
MGVEIETITPGDGQTFPKKGQTCVVHYVGSLTDGTKFDSSRDRGTPFKFKIGKQEVIRGW
EEGVGQMSVGQRATLTCTPDFAYGSKGHPGIIPPNSTLIFDVELMGLE
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagagatcgagaccataaccccgggtgatggccagacatttcccaaaaaaggg
cagacatgcgttgtgcattatgtcggctcactgactgatggaaccaagtttgactcatcc
cgggacagaggcacgcctttcaagttcaagattggcaagcaggaggtgatccgtggctgg
gaggagggggttggccagatgagcgtgggccagagggcgaccctgacctgcacgccggac
ttcgcctatggcagcaaagggcaccctggcatcatcccacccaactctacactaatcttt
gatgtggagctgatgggcctggagtga

DBGET integrated database retrieval system