KEGG   Salmo salar (Atlantic salmon): 106568968Help
Entry
106568968         CDS       T04363                                 

Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase-like
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00514  Other types of O-glycan biosynthesis
sasa00515  Mannose type O-glycan biosynthesis
sasa00533  Glycosaminoglycan biosynthesis - keratan sulfate
sasa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    106568968
   00514 Other types of O-glycan biosynthesis
    106568968
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    106568968
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    106568968
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:sasa01003]
    106568968
Enzymes [BR:sasa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     106568968
Glycosyltransferases [BR:sasa01003]
 Terminal extension
  Sialyltransferase
   106568968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 106568968
NCBI-ProteinID: XP_013995341
UniProt: A0A1S3LXJ7
Position
ssa14
AA seq 377 aa AA seqDB search
MKPSHKLLFVLCPMLVLGFIYYSSGKLHLPVWGQKPQLEADIALTVGQIVGSVYDKQGFL
LKLDGRFWPAELAYKYGNLSEGVCKPGYAAAKMTAIYPNSSHRFMKPAPMFLDRNFKRLA
KVRNYLPPFGFKTQERIIDSILTATKNYGLGEDLDSLGCKRCIIVGNGGILANKSLGSRI
DDYNIVVRLNEAPVTGFSKDVGTKTTMRITYPEGAIQKPERYEKDSLFVFSAFKPLDFKW
LRQMVFKEKLRGTEGFWKSVAHYVPREPTEMRILNPYFIQEAAFQFIGLPLNNGLMGKGN
IPTLGTVAITMALHNCDEVAVAGFGYDMNMPHAPLHYYETVKMSAIKESWTHNISKEKEF
LRKLVKANVITDLTNGI
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcacacaagctgctgttcgtcctgtgccccatgctggtcctgggcttcatc
tactactcctctgggaagctacacctgcctgtatggggccagaagccacagttggaagcg
gacattgctctcaccgtgggacaaatagtaggctcagtgtatgataagcagggctttctg
ctgaagctggatggacgtttttggccagcggagttggcgtacaagtatggcaacctcagc
gaaggagtttgcaagccgggctacgcagcggcaaagatgaccgccatctatccaaattct
tctcacaggttcatgaagccagctcccatgtttctcgaccggaacttcaagcggcttgcc
aaagtccgcaattacttgcctccatttggattcaaaacacaagaaagaatcatagacagt
attctaactgccacaaagaactatggcttgggtgaagaccttgacagtcttggttgtaaa
agatgcattattgtgggcaatggtggtatcctggccaacaagtctttgggctcgcgcata
gatgattacaacattgtggtgaggttgaacgaggctcctgtgactggtttcagcaaggac
gtgggcaccaagaccacgatgcgcatcacctaccccgagggggccattcagaagcctgag
cgctacgaaaaggactcgctattcgtcttctccgccttcaaaccgctggacttcaagtgg
ctcagacaaatggtcttcaaagagaaactgcggggtacagagggcttctggaagtctgtg
gcacactacgtacccagggagcccacagagatgcgcatcctcaacccctacttcatccag
gaggctgccttccagttcattggcctgccgctcaataacggcctcatgggcaaagggaac
attccaaccctggggaccgtcgccataacaatggcgctgcataactgtgatgaggtggcg
gtggccggcttcggttatgacatgaacatgcctcacgcacccttgcactactacgaaacg
gtcaagatgtctgccatcaaagagtcctggacacacaacatatccaaggagaaggagttc
ctccgcaagctggtgaaggccaacgtcatcacggacctgactaacgggatctga

DBGET integrated database retrieval system