KEGG   Salmo salar (Atlantic salmon): 106569285
Entry
106569285         CDS       T04363                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor-like
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106569285
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106569285
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9
Other DBs
NCBI-GeneID: 106569285
NCBI-ProteinID: XP_013995946
UniProt: A0A1S3LYP2
Position
ssa14
AA seq 663 aa
MMIPPGDCLYAGRKRRKPIQKQKQTAASQKTNPSKRHRDRLNAELDRLASLLPFTPDIIS
KLDKLSVLRLSVSYLRVKSFFQAIQEKPCRKHIMEPPVNHQDTRKESLSMGTPGTSSSMV
ESDLLLESLTGFALVVSTDGLIFYTSTSIVDYLGFHQTDVMHQNVFDYIHVEERQEFRRQ
LHWAMNPGTQGASLDQHSATGTGDDFVMSSLFHAQEPDGVPLERTSFLTRCFISRVRCLL
DSTSGFLSMQFQGSLKFLQGQKKKTDSGELLPPQLALFCVAVPLMMPFITELKMKSMTIR
NKNKGPVIPTPDKHSDKRHRSTRGSCDSSDLLLLNWSSSSTRDPCHYTPWTPLSKDGIRY
RNNGYYTQEEPINFCLSSMGGGPKAQSVNHPWNIRTGPTIRKDPSSSYIPGRQSQYNNLG
KSGAYRMSPGYHAKRQDASQNKLYGGLHSPEVESFCEDGMKADNNYIGGHLDCYNGMVLP
ETAIKTEQDSDSENGCNIYSMPHNGAWVGNEKRYSMGYSEEPQVKSEADYYDQYTTCQRN
KSSMSPTLNGYHKYLYPVGSRAQKDHRIPHSDPLCSSQGANCMDSNVYGNGTVEHKGYMQ
QDNKLNYKFRNHLVHSIKREPMDSPPWSDNGHDIRQIPLQRNMIHNCALTDIVHKPNPYI
YMQ
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgatgattccacctggggactgcttatatgccgggaggaagagaaggaagcctatccaa
aaacaaaaacagacagcggccagccagaagaccaacccatctaagaggcaccgtgaccgt
ctgaatgcagagctggaccggctggccagtctcctacccttcaccccagacatcatctcc
aaactggacaagctctcagtgctgcgtctcagcgtcagctacctccgggtcaaaagcttc
tttcaagccatccaggagaagccatgcagaaagcacatcatggagccacctgtgaaccac
caagataccaggaaagagagcctgtccatggggaccccggggaccagcagcagcatggtg
gagagtgacctcttactggagtccctgactgggtttgctttggtggtgagtacagacggg
ttgatcttctacacctccacctccattgttgactacttgggctttcatcagacggatgtg
atgcaccagaatgtttttgattatatccatgtggaggagcggcaggagttcagaagacaa
ctccactgggccatgaaccccgggacccagggggcctccctggaccagcactcagccaca
ggaactggtgatgactttgtgatgagcagtctcttccacgcccaggagcctgatggtgtt
cctctagagcgcacctccttcctcactcgctgtttcatttcccgtgtccgttgcttgctg
gacagcacctcaggcttcctgagcatgcagttccagggcagcctgaagttcctgcagggc
cagaagaagaagacagactctggggagctgctgcccccccagctagccctgttctgtgtg
gccgtgcccctcatgatgcccttcatcacagagctgaagatgaagagcatgacgatcagg
aacaagaataagggccccgtcatccccacaccagataagcacagtgacaaaaggcatcgc
tccaccagaggttcatgtgacagcagtgacttactgcttctgaattggtccagcagctca
accagagatccctgccactacaccccatggacacccctctccaaagacggcatcaggtat
aggaacaatggttactacacccaggaggagcccatcaacttctgcctgtcttccatgggt
ggtgggcccaaagctcagagcgtgaatcatccatggaacatccgcaccgggcccaccata
agaaaggaccccagcagcagctacataccaggcagacaaagccagtacaacaacctgggg
aagtctggagcttacaggatgtctccaggatatcatgctaaaagacaggatgcctctcag
aacaaactgtatggaggcctccacagcccagaagtggagagcttctgtgaggacggcatg
aaggcagacaacaactacattggcggccatcttgactgttacaatggcatggtgttgcct
gagacagccataaagacagagcaggattctgactctgagaacggttgcaacatctacagc
atgccccacaacggagcctgggtggggaacgagaagcgctacagcatgggctactcagaa
gaaccacaggtgaagtcagaggctgactactacgaccaatacaccacctgccaaaggaac
aagtccagcatgagcccaacgctcaacggataccacaaatacttatatccagtggggagc
agggctcagaaggatcataggatacctcactcagaccctctgtgtagcagtcagggagca
aactgtatggacagcaatgtatatgggaatggtactgtggagcataaaggctacatgcag
caagacaacaaactgaactacaagttcaggaatcatctggtccactctataaagagggaa
cccatggactcacctccttggtctgacaatggacatgacattagacaaatacccctgcag
agaaatatgattcacaactgtgcattgactgatattgtacacaaaccaaacccatatatc
tacatgcaatga

DBGET integrated database retrieval system