KEGG   Salmo salar (Atlantic salmon): 106570844
Entry
106570844         CDS       T04363                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sasa01002]
    106570844
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     106570844
Peptidases and inhibitors [BR:sasa01002]
 Metallo peptidases
  Family M1
   106570844
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 106570844
NCBI-ProteinID: XP_013998888
UniProt: A0A1S3M6J1
Position
ssa15
AA seq 957 aa
MRTLTVTILVLLHVSFAPSLAAQLPGDHDTNDKSSSLLPPIATNGQPFPWIHMRLPETVS
PIHYDLLVHPNLTSLDFTGEVQIQLQVFEDTSTIILHSKDLQIAKAELLAPEGPGSLPVP
LQVLEYPAFHQLALMSDVLLVRGGMYKVRLEFSANLSDSFHGFYKSSYRTTKGEVRFMAS
TQFEATSARAAFPCFDEPAFKANFTIQIRRESRHIALSNMPKVKTVELPGGVLEDHFDTS
VRMSTYLVAFIVSDFQSVSKTTSHGVKISVYAVPDKINQTDFALNAAVRLLDFYDDYFDI
PYPLPKQDLAAIPDFQSGAMENWGLTTYREAGLLFDPNKSSASDKLGITMVIAHELAHQW
FGNLVTMQWWNDLWLNEGFAKFMEFVSVNITNPELQVNDFFLGKCFEAMEVDSLSSSHPV
SSQVDTPTQIQEMFDDVSYDKGACILNMLRDFLTPEAFKIGIVRYLRRYSYQNTVNSHLW
ESLTNICQSDDLDEGRLKDEGFCSQEKAQSGAPKWYSGDQLDVRAIMDTWTLQEGFPLVT
VEVRGRQVRLSQERYLKTDDPSQTHGFLWQVPLTYITSSSSTVHRFLLKTRTDVLYLPEE
VGWIKFNVDMSGYYMVHYEGEGWRSLTSLLLTNHRALSSNDRASLINNAFQLVSVGKVGL
DTALDLSLYLSKETDIMPVTQGLGELVPLYKLMEKRDMEGLENQMKGYIVELFRGLIDRQ
TWSDDGSVSQRVLRSYLLLFGSVRNHPPCVATATHLFNKWRASDGNMSLPSDVSLAVFAI
GARDPEGWDFLFEKYRHSQHTSVKSRIKSALSISPLQHKLKRLMEQSLAGEVMKTQDLPH
VVISVSRNPKGYKLAWDFLRHNWHTLVKKFDLGSHSISGMVTGVTNQYSTREMLDEVRGF
FDSLSEETGSGLRCIQQTYESIEENIRWMDQHLPQLKAWLDRQAQGARTETQGHEDL
NT seq 2874 nt   +upstreamnt  +downstreamnt
atgaggacgttaactgtcaccatcctggtgctcctgcatgtatcctttgccccgtctttg
gcggcacagcttccaggagaccatgataccaacgacaagtcttcctcacttctacctccc
atcgccactaatggccaacctttcccctggatccatatgagacttcctgaaactgtctct
ccaatccactatgacctcctcgtccaccctaacctgaccagcctagacttcaccggagag
gtgcagattcaactccaggtcttcgaggacacctctaccatcatcctccacagcaaggac
ctccagatagctaaagctgagctcttggcaccggaaggtccagggtcactgccagtgcct
ctgcaggtgttggagtacccagccttccaccagctagctctgatgtctgatgtgctgctg
gttagaggtgggatgtacaaggttcgtctggagttctctgccaacctgtctgacagtttc
cacggtttctacaagagctcctatcgcacaactaagggagaggtcaggtttatggcgtcc
actcagtttgaagcgaccagtgcccgagcagccttcccctgtttcgatgagccggcgttc
aaagccaacttcaccattcagatacggcgggagtcacgccacatcgccctctccaacatg
cccaaggtaaagacagtagagttaccaggtggcgtgctggaggaccactttgacaccagc
gttaggatgagcacctacctggtggccttcatcgtctctgacttccagtctgtcagcaag
accaccagtcacggagtcaagatctcagtgtatgctgtaccagacaagatcaaccagaca
gactttgccctgaatgctgcagtcagactgttggacttctacgatgactactttgacatc
ccatatcctctacccaaacaggacctggcagctatcccagacttccagtcgggtgcgatg
gagaactggggtctgaccacataccgagaggctgggctgctctttgaccccaacaagagc
tccgcctctgacaagctaggcatcaccatggtgatcgcacatgagctggcacaccagtgg
ttcggtaacctggtgaccatgcagtggtggaatgacctgtggctcaacgagggctttgca
aagttcatggagtttgtgtcagttaacatcaccaaccctgagctgcaagtgaatgacttc
ttcctagggaagtgttttgaggcgatggaggtggattcattaagctcctcccaccccgtt
tccagccaggtggacactcctactcagatccaggagatgtttgacgatgtctcctatgat
aagggggcgtgtattttgaacatgctgagagacttcctgaccccagaggcgtttaagatt
ggtattgtccgctacctcagacgttacagctatcagaacactgtcaacagccatctgtgg
gagagcctcactaacatctgccagtcagatgatctggatgagggcagactgaaagacgag
gggttctgttctcaggagaaggcccagtctggagctcctaagtggtactcaggcgatcag
ctggatgtgagggccatcatggacacgtggacgctgcaggaggggtttcccctggtcact
gtagaggtcaggggtcgccaggtcagactcagccaggagagatacctcaagactgacgat
ccctcacagacacacggcttcctgtggcaggttcctctgacctacatcaccagcagctcc
agcacagtgcatcgcttcctgctcaagaccaggacagacgtgctgtacctaccagaggag
gtggggtggatcaagtttaacgtggatatgagtggttactacatggtccattacgagggg
gaaggctggcgttctctgacctccctgctgctaaccaatcacagggctctgagctccaac
gaccgcgcttccctcatcaacaatgccttccaattggtcagtgttggtaaggtaggactg
gacacagccttggacctgtctttgtatctgtccaaggagacagacatcatgcctgtcacc
cagggtctgggggagctggtccctctctacaaactgatggagaagagagacatggagggt
ctggagaaccagatgaagggctacattgtggagctgttccggggtttgatagaccgtcag
acgtggagtgacgacggctctgtttcccagagggttctaaggagctacctgctgctgttc
ggctctgtcaggaaccatcccccctgtgtcgctaccgccacacacctcttcaacaagtgg
agggcctccgacggcaacatgagtctccccagtgatgttagcttggcggtgtttgccatt
ggtgctcgtgaccccgaggggtgggatttcctctttgagaagtaccgccattcgcagcac
acatctgtcaagagccgcatcaagtctgccctgtccatcagccctctgcaacacaagcta
aagcggttaatggagcagagtcttgcgggcgaggtgatgaagactcaggaccttcctcat
gtggtcatctctgtcagcaggaaccccaaagggtacaagctggcctgggacttcctcaga
cacaactggcacacactggtgaagaagtttgacctggggtcccactctatctcaggcatg
gtgaccggtgtgaccaaccagtactccaccagggagatgctggacgaggttcgcgggttc
tttgactctctgtctgaggagacaggttctggtctgaggtgtatccagcagacatatgaa
agcattgaggagaacatccgctggatggaccagcacctgccccagctaaaggcctggctg
gacagacaggcccagggagccaggacagagacacagggccacgaggatctatag

DBGET integrated database retrieval system