KEGG   Salmo salar (Atlantic salmon): 106570847Help
Entry
106570847         CDS       T04363                                 

Definition
(RefSeq) probable palmitoyltransferase ZDHHC19
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106570847
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106570847
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 106570847
NCBI-ProteinID: XP_013998890
UniProt: A0A1S3M755
Position
ssa15
AA seq 384 aa AA seqDB search
MDSDNEKPRKKKRRPHWIVRGLGPSFTACMGFVISVLYITFPCAWLATHVSVAYPVASAM
LLTGTLVTFLVSSFMDPGILHQGPPWPGTAEVAYVIVNGQRYDMDWCSRCEIYLPPAAWH
CRRCNACVDRFDHHCEWLNNCVGRRNYRVFLLFLLLLTSYLLLVLSSSLFYLFLTLLTLH
QPFSLPHATTVVVMVTSLACVLLVLVILISNIKLISNGEPSSTIEPYFEPDDKNPFDQGC
WKNWTHVLCSPTGPRYLGAVKPSSRGDTEGDWSSLTLLHQEDQCLYSCSSVPCCNTCKHH
QVAVGPASPGHFKHSTLSLDSLKEGRGCCCCYREVVPAGCVTTDKHSDNNKPPQSSAVEI
PDMLAAGDEDLDQERDGVLIRAAK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggactcggacaacgagaagccgcgcaagaagaagagacggccgcactggattgtgaga
ggcctcgggccgagttttactgcctgcatgggtttcgtaataagcgtgctgtacatcact
ttcccgtgcgcgtggttggctactcatgtttcagtggcctatcctgtggcctctgcaatg
ttactaactgggaccttggtaactttcctggtgtcaagtttcatggatcctggcattctc
caccaaggccccccatggccaggcacagcagaggtggcctatgtgatagtgaatggtcag
aggtatgatatggactggtgcagtaggtgtgagatctaccttccccctgctgcatggcac
tgccgtcgctgcaatgcctgtgtggaccggttcgaccaccactgtgagtggctgaataac
tgcgtggggagacgtaactaccgtgtgttcctgctcttcctcctgctgctgacgtcatac
ctgctcctggtcctctcctcctctctgttctacctcttcctcaccctcctcaccctgcac
cagcccttcagcctgccccacgccaccactgtggtcgtcatggttaccagcctggcctgt
gtactcttggtcttggttatactcatcagtaacatcaagctgatctccaatggagagccg
tcttctactatagagccctactttgagcctgatgataagaacccgtttgatcagggctgc
tggaagaactggacccacgtcctctgttccccgactggacccaggtatctgggggctgtg
aagcccagcagcagaggagacactgagggggactggagcagtctaacccttctccatcag
gaggaccagtgtttgtacagctgcagctcagtcccctgttgtaatacttgtaaacatcac
caggtggcggtaggcccagccagcccaggccatttcaagcatagcacactgagtctagac
agtctgaaggaagggagagggtgttgctgctgctacagggaagtagtaccagccggctgt
gtgacaacagacaaacacagcgacaacaacaagcccccacagagctctgctgtggagatc
ccagatatgttggctgctggtgatgaggacttggaccaggaacgggatggagttctgatc
agagcagcaaagtag

DBGET integrated database retrieval system