KEGG   Salmo salar (Atlantic salmon): 106570901Help
Entry
106570901         CDS       T04363                                 

Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00480  Glutathione metabolism
sasa00590  Arachidonic acid metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106570901
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106570901
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106570901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA CP2 Redoxin
Motif
Other DBs
NCBI-GeneID: 106570901
NCBI-ProteinID: XP_013998951
UniProt: A0A1S3M7L4
Position
ssa15
AA seq 215 aa AA seqDB search
MEALEVLGGYPTKPLNPRARMVRFLLSIMVCMGCLLMLHSFLNISKSRKPQDFYSFEVKD
ANGKSVSLERYRGKASLVVNVASHSEHTEKNYRSLQELHRELGTSHFNVLAFPCGQFGDT
EMGASREIEAYAKNTYSVTFNIFSKVKIMGSEAEPAFKFITDSVKKVPKWNFWKFLVNPE
GQVVRFWKAEEPAESVRKEARTMVRQIILKKRTEL
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgctggaggttttggggggctacccgaccaagcccttaaacccgagagcccga
atggtcaggtttctactgagtataatggtgtgcatgggatgtttattaatgctacatagt
tttctcaacatctccaagtccaggaagccgcaagatttctattcttttgaggtgaaggac
gccaacgggaaaagcgtttctttggagagataccgaggcaaagcgtctctggttgtcaac
gtggcgagccacagcgaacacactgagaagaactatcgctctctgcaggagctgcaccgg
gaattgggtacgtcccatttcaacgtcctggctttcccctgcggccagtttggggacacg
gagatgggggccagccgggagatcgaggcctacgccaagaacacctatagcgtcaccttc
aacatcttcagtaaggtcaaaatcatggggtcggaggcagagccagccttcaaattcata
acagattctgtgaagaaggttccgaagtggaacttctggaagttcctggtgaaccctgaa
ggccaggtggtgaggttctggaaggcagaggagcccgccgagagcgtgcgtaaggaggcc
agaaccatggtgcgccagattattctaaagaaaaggacagagctctga

DBGET integrated database retrieval system