KEGG   Salmo salar (Atlantic salmon): 106571864Help
Entry
106571864         CDS       T04363                                 

Gene name
MAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2-like
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04218  Cellular senescence
sasa04370  VEGF signaling pathway
sasa04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106571864 (MAPK2)
   04370 VEGF signaling pathway
    106571864 (MAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106571864 (MAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106571864 (MAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106571864 (MAPK2)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106571864 (MAPK2)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   106571864 (MAPK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like MAM1 Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 106571864
NCBI-ProteinID: XP_014000842
UniProt: B5X316
Position
ssa15
AA seq 388 aa AA seqDB search
MLSNPQNQNQPAFPNQQQQQVPNLNSAPFPPFFVKPHNPLQIKKNAITDDYKVTNQVLGM
GINGKVLEIFQKGSGDKYALKMLQDCAKARREVELHWRASPCSHIVRIMDVYENLYQSRK
CLLIVMECMDGGELFSHIQDRGNQAFTEREASDIMKSIGEAIQYLHAIDIAHRDIKPENL
LYTSKKPDALLKLTDFGFAKEITTLNSLATPCYTPYYVAPEVLGPEKYDKSCDMWSLGVI
MYILLCGYPPFYSNHGLAISPGMKKRIRNGQYEFPNPEWSDVSEDAKQLIRHLLKTEPTQ
RMSITEFMNHPWINQSMEVPQTPLHTSRVLQEEQDVWEEVKEEMTSALATMRVDYEQIKI
KTIEDSTNPLLIKRRKKANNAATEPPGL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgaatcctcaaaaccagaaccaaccggcgtttccgaaccagcaacaacagcaa
gtgccaaatctgaactctgctccatttcctccgtttttcgtcaaaccccacaaccctctt
caaataaaaaagaatgccataactgacgactacaaagttacaaatcaagtccttgggatg
ggcatcaatgggaaagtattggaaatattccaaaaaggaagtggagataaatacgctctg
aagatgctgcaggattgtgcgaaggctcgtcgggaggtagagctccactggagggcgtcg
ccatgctctcacatcgtacgcatcatggacgtctacgaaaacctctaccaaagcaggaag
tgcctgctcatcgtcatggagtgtatggatggaggtgagctattcagccatattcaagac
cgagggaaccaggcattcacagaaagagaggcctctgacatcatgaagagtataggagaa
gccatccagtatctgcatgccattgacatcgctcacagagacattaagccagaaaatctg
ttgtacacctccaaaaaaccagatgcactcctcaaactaaccgattttgggtttgccaaa
gaaatcaccacactcaactccctggcaacgccatgctacaccccttattatgttgcccct
gaggttcttggtccagagaagtacgacaaatcctgtgatatgtggtctctgggtgttatc
atgtatatcctgctgtgtggatatcctcccttctactctaaccacggcctggccatctcc
cctgggatgaaaaaacgcatcaggaacggacagtacgagttccccaacccagagtggtct
gacgtgtcagaggacgccaagcagttgatccgccacttactaaagactgagcccacccag
aggatgagcatcacagagttcatgaaccacccctggatcaatcagtctatggaggtccct
cagacccctctccacaccagtcgtgtgctgcaagaggaacaggatgtctgggaggaggtc
aaggaggaaatgacaagtgccctggcaaccatgagagtggactatgagcaaatcaaaatc
aagaccatcgaggattcgaccaatccgctgctgattaagagaaggaagaaggcaaacaat
gcagccactgaaccaccgggcctgtga

DBGET integrated database retrieval system