KEGG   Salmo salar (Atlantic salmon): 106572705Help
Entry
106572705         CDS       T04363                                 

Definition
(RefSeq) glucose-6-phosphate 1-dehydrogenase-like
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00030  Pentose phosphate pathway
sasa00480  Glutathione metabolism
sasa01100  Metabolic pathways
sasa01200  Carbon metabolism
Module
sasa_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sasa_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    106572705
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106572705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sasa04147]
    106572705
Enzymes [BR:sasa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     106572705
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     106572705
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   106572705
  Exosomal proteins of colorectal cancer cells
   106572705
  Exosomal proteins of bladder cancer cells
   106572705
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G6PD_C G6PD_N FlaA
Motif
Other DBs
NCBI-GeneID: 106572705
NCBI-ProteinID: XP_014002583
UniProt: A0A1S3MH94
Position
ssa15
AA seq 541 aa AA seqDB search
MRQHDTETAEREPGLTYSTETTHQMEKMSGVPGCLTHSEVLGQLRRELSHSSDLHIFIIL
GASGDLANKKIYPTLWWLFRDELLPEETHFVGFARSKLTMEDIRTACLPHMKVGDGESER
LAAFFSRNSYLSGRYDEEDSFSELNAHLSSLTTSRGADHANCIFYLALPPSVYHHVSKNI
RAHCMCRKGWSRVIVEKPFGRDLQSSQELSSHFSSLFREDQIYRIDHYLGKEMVQNLMVL
RFGNRIFGPIWNRNSVACVVLTFKEPFGTQGRGGYFDDFGIIRDVMQNHLLQMLSLVAME
KPASTSPDDVRDEKVKVLKCIAPVPRSDVVLGQYIGDPEGESHARLGYLDDPTVPNGSRT
PTFATSVLYVQNERWDGVPFVLRCGKALNERKAEVRLQFTDVPGDIFNEQCQRNELVVRV
QPDEAIYLKMMTKKPGAYFSPEETELDLTYRSRYKDVKLPDAYERLILDVFCGNPMHFVR
SDELREAWRIFTPLLHHIEGEKTPPISYTYGSRGPNEADELVRRVGFRYEGTYKWVNPHS
A
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacacgacacagagacagcagagagggaaccaggcttgacatacagtacagag
acaacacaccagatggagaagatgagtggtgttcctgggtgtctcacccactctgaggta
ttgggtcagctgagaagagagctgtcccattcatctgacttacacatcttcatcatactg
ggagcctcaggagatcttgccaataagaagatctatcctactctatggtggctgttcaga
gatgagcttctcccagaagagacccactttgtgggctttgctcgctccaagctgaccatg
gaggacatcaggacagcatgtctgccacatatgaaggttggtgatggtgagagtgagcgc
ctcgctgcgttcttcagtaggaactcttacctgagtggcaggtatgatgaggaggactcc
ttctctgagctgaatgcccacctgagctccctgaccaccagcaggggggctgaccatgct
aactgtatcttctacctggcactgccccccagcgtctaccatcatgttagcaagaacatc
agagcccactgcatgtgccgcaaaggttggagcagggtgatagtggagaagccatttggt
cgtgacttgcagagttctcaggagctgtcgtcccacttctcctccctgttcagagaagac
cagatctaccgcatagaccactacctgggcaaggagatggtgcagaacctcatggtcctc
aggtttgggaaccgtatctttggtcctatctggaacaggaacagcgtggcctgtgtggtt
ctaacctttaaagaaccattcggtacacagggacgcggaggatactttgatgactttggc
attatccgtgatgtcatgcagaaccacctcctccagatgctctctctggttgccatggag
aagcctgcctccaccagccctgatgacgtcagagatgagaaggtgaaggtgttgaagtgc
atcgccccagtgcctcggtctgatgtggtgctgggtcagtacataggggaccctgagggg
gagagccatgccagactgggttacctagacgaccccaccgtgcccaacggctcccggacg
cctaccttcgccacctctgtgctctacgtacagaatgagagatgggatggtgttccgttc
gtcctgcgttgcggtaaggcactcaacgagcgtaaggcggaagtgcgtctccagttcacg
gatgttccaggggacatctttaatgagcagtgccagaggaatgagctggtggtgagggta
cagcctgatgaggccatctacctcaagatgatgaccaagaagcctggagcttacttcagc
cctgaggagactgaactggaccttacctacaggagcagatacaaggacgtgaagctccct
gatgcatatgagcgtcttattctggatgtgttctgtgggaatccgatgcactttgtccgc
agtgatgagctgcgagaagcctggaggatcttcactcccctcctccatcacatagaggga
gagaaaacacctcctatctcttacacctatggaagtcgtggaccaaatgaagcggatgag
ctcgtgaggagggtgggattccgctacgagggaacatacaagtgggtcaacccccacagt
gcatga

DBGET integrated database retrieval system