KEGG   Salmo salar (Atlantic salmon): 106573309Help
Entry
106573309         CDS       T04363                                 

Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2-like
Organism
sasa  Salmo salar (Atlantic salmon)
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 106573309
NCBI-ProteinID: XP_014003726
UniProt: A0A1S3MLM1
Position
ssa16
AA seq 2666 aa AA seqDB search
MSDNRSSFLHIGDIVSLYAEGTVNGFISTLGLVDDRCVVQPDAGDLAIPPKKFRDCLFKV
CPMNRYSAQKQFWKAKQGKQGNNDTEADLFKKLQHAAELEQKQNDTENKKLLGEVVKYSN
VIQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDPSGNEGSWFYIQPFWKLRSEGDNVVVG
DKVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKVTLFMKFSDYREDVLKGGDV
VRLFHAEQEKFLTCDEYRNQQHIFLRTTLRQSATSATSSKALWEIEVVHYDPCRGGAGQW
NSLFRFKHLATGSYLAAETNPDFRDESVDSKAEVSQTETDTVFSQRKRQAAEKIAYTLVS
VPHGNDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTNFPIDTEEERPVMLK
IGTCRTKEDKEAFAIVSVPLSEVRDLDFANDANKVLELTVRQLQCGNIAQNDRRFVTKLL
EDLIFFVCEVPNNGQDVLSVVISNPNRERQKLMREQNILAQIFGILKAPFTDQGEGPMLK
LEDLGDQRYAPFKYMLRLCYRVLRHSQQDYRKNQEYIAKKFSIMQSQIGYEILAEDTITA
LLHNNRKLLEKHITAKEIETFVNLLRRNREPRFLDYLSDLCVSNKTAIPVTQELICKFIL
NPANAEILIQTKLIPSMETTLQSSMLQEDTEEDEEVWLYWIDSHKEPHGKSIRHLAQDAK
GNHKLDNDVITYYRYQLNLFAKMCLDRQYLAINQVSSQLPVDLILRCMFDDCLPYNLRAS
FCRLMLHMHVDREPQEAVVAVRYARLWTEIPSKITIHEYEYEFTDTSREEMKRKFAPTME
FVEEYLKDVVSQPFPFGDEEKNELTLEVVHLARNLVYFGFYSFSELLRLTRTLLAILDFV
QHPLTDMAELSKSPEAGNNVFRTIHGVGEMMTQMVLSRGHVQPHHLPNTPPSLQDRKQPL
CLTDNEDVMVMDTKLKIIEILQFILSVRLDYRITYLLSIYKKEFGDSNLPDSSMSLSEFP
SMSVSDPDIDEIAAKAETMFAGSSECSAVELDDEGGRTFLRVLIHLIMQDYTPLVSGSLQ
LMFKHFSQRAEVLQAFKQVQLLVSEQDVENYKQIKTNLDQLRLAVEKSELWVEKSGGYGN
EDIGDSQVKEQTMEEAGILSPVQDGDVKPHIDSNKANNYNIVKEILLRLSKLCYPSKKSC
VQQQRLLKNMGAHSVVLDLLQIPYEKSDAKMNEIMTLAHVFLQYFCRGNSQNQALLHKYL
NLFLSPGLLEAETMRHIFMNNFHLCNEISDRVVHHFVHCIETHGRHVQYLKFLLTIVKAD
GKYVKKCQDKVMTELVNGGEDVLVFYNDRSSFPVLFQMMCCELERRDEDGALAYHNTLVE
LLAVCTEGKNVYTELKCNSLLPLDDIVKVVTHEDCIPEVKTAYVNFVNHCYVDTEVEMKE
IYTSHHIWKLFENFLVDMARVCNSTTDRNHANVPLERYVTETVMAVVKGFFSSQFPVNNS
NLQTHQPIFIQLLQSSFRIYNCTWISSAQKNNIEGCIKTLADVAKARAIAIPVDLDSQVN
TLSLKAHTYRVERAVKDWRTSARTRLRKEILGVPDYKSIIEKLQGVVACLEEQFSPMVQA
EFSVLVDVLHSPELLFPEAARLRCESGAFMSKLIKHTKKLMDKEEKLCIKILQTLREMLV
KKEAFDEPGNVLRKILLTRYFGKKRLHSKSEFGSGNSSAGGGSLVQDSDKLSSSMVDIQC
LLDSEGASELVIDLIVSTKNDCMFEESILLGNALLQGGNTQIQNSFYHQLHKQKKSEHFF
KVFYDRMRLAQQEIRATVSVNMFEVSTCRKRDEDVDVSYSGIRLRKTPKDSSLHMVDNMR
GQLKEASSATSKAFVSFRKERDTDLEVLEGQAGEGPGGGAEEREEEAQMSRAITIMKPIL
RYLQLLCENHNRDLQNFLRNQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGLYINEGNV
DLVRQTLETITEYCQGPCHENQSCIAKHESNGIDIIIALIVNPVNPLGKHRLDLVLELKS
NASKLLLAIMESRHDSENAEKILYKMRPMELVDVMKEAYAQGLESEAEENAIGDQIKPKD
VGHNIYILAHQLARHSKFLQQSLRPPATGLLLSHKIEGEDALSYYANHTAQIEIVRHDRT
MEQIVFPVPNICEYLTEESKTRVFTTTERDDQGSKVNDFFTQFDDLYNEMRWQKKIRNNL
ALFWFSRHISLWGSISFYLAVLVNVAVALFYPFGDGEDEGILPPFVSILLWVALVVCTTM
LFILPKPGSVRPFLVSVILRSIYTLGLDPTLLLLGAANLLNKIVFLVSFVGNQGTFTRGY
KPVVMDMPFLYHVGYVIVCMLGLFVHEFFYSFLLFDLLNREETLLNVVKSVTRNGRSIVL
TAVLALILVYLFSIVGFLFLKDDFRMDVQRLPVMAGEDDGTERVCDTLLMCIVTVLNQGL
RNGGGVGDVLRKPSKDDPLFVARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEKQRK
EEILKTTCFICGLERDKFDNKTVSFEEHITSEHNMWHYLYFLVLVRVKDPTEYTGPESYV
AQMIKEKNLDWFPRMRAMSLVSSEGESEQNEMRSLQEKLDGTVKLVSLLSSQLFELKEKM
TEQRKNKQRLGFLGTHGVNNHHIPAH
NT seq 8001 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaacagatctagttttcttcatattggagacattgtgtcgctttacgcggaa
ggcactgtcaatggcttcatcagtacattggggcttgttgatgacaggtgtgtggtgcag
ccggacgcaggagacctggccattccgcccaaaaagttcagagactgcctgttcaaggta
tgtccgatgaacaggtactcagctcagaagcagttctggaaagccaaacagggcaaacaa
ggcaacaatgacacagaagcagacctattcaagaagttacagcatgcagcagaactggaa
cagaagcaaaacgacaccgagaataagaagctgcttggagaggtggtcaagtacagtaac
gtcatccagcttctgcatataaaaagtaacaagtacctgacggtgaacaagcgtctgccg
gcgctgctggagaagaacgccatgcgtgtgtctctggacccatccggcaatgagggctcc
tggttctacatccagcccttctggaagctccgcagcgagggtgataacgtggtggtggga
gacaaggttgtcctgatgcctgtgaatgcaggacagcctctccacgccagcaacattgag
ctgctagacaaccccggctgcaaggaggtgaacgctgtgaactgcaacaccagctggaag
gtcactctgttcatgaagttcagtgactacagagaggacgttctcaaaggaggtgatgtg
gtgcgtctgttccacgccgagcaggagaagttcctgacatgtgacgagtacaggaatcag
cagcacatcttcctcaggaccaccctgcgacagtctgccacctccgccaccagttccaaa
gcactctgggaaatagaggttgtgcactacgacccctgcagagggggtgccggccagtgg
aacagcctgtttcgcttcaaacacctggccactgggagctacctggctgcagagacaaat
cctgatttccgggatgagagtgtggattctaaagcagaggtgagtcagacggagacggat
acagtgttctcccagaggaagcgtcaggctgcagagaagatcgcctacaccctggtgtct
gtgccccatggcaacgacatcgcctctctgtttgagctggacgccaccacgctgcagagg
gctgactgtctggtgcccaggaactcgtacgtacggctgaggcacctgtgtaccaacacc
tgggtgactagcaccaactttcccatcgacactgaggaggagcgccccgtcatgctcaag
attggcacgtgtcgtacgaaggaggacaaggaggcatttgccattgtctctgtgcccctg
tctgaggtccgagaccttgactttgctaacgatgccaacaaggtcctggagttgaccgtg
agacagctgcagtgtggtaacattgctcagaacgataggaggtttgtgaccaagctgttg
gaggacctgatcttctttgtgtgcgaggtccccaacaacggacaggacgtgctgtctgtg
gtcatctccaacccgaacagagagcggcagaaactaatgagggaacagaacattctagcc
cagatttttggtattctgaaggccccgttcacagaccagggggagggtcccatgctgaag
ctggaggacttgggggaccagcgctacgctccctttaagtacatgctgcggctgtgctac
cgggtgttgcgccactcccaacaggactaccgcaagaaccaggagtacatagccaagaag
ttctccatcatgcagtctcagatcggttatgagatcctggcggaggacaccatcactgcc
ctgctccacaacaaccgcaagctgctggagaaacacatcacagccaaggagatcgagacc
ttcgtcaatctgctgcgtcgcaaccgagagcccaggtttctggactacctgtcagacctg
tgcgtgtccaataagacggccatcccagtgacacaggagctcatctgtaaattcattctg
aaccccgccaacgctgaaatcctcatccagaccaagctcatccccagcatggagactacc
ctgcagtcgtccatgctgcaggaggacaccgaggaggacgaggaggtgtggctctactgg
attgacagccacaaggagccacacggcaagtccatccgccacctggcccaggacgccaag
ggcaaccacaagctggacaacgacgtcatcacctactacagataccagctcaacctgttt
gccaagatgtgtctggaccgccagtacctggccatcaaccaggtgtccagccagctgccc
gtggacctgatcctgcgctgcatgtttgacgactgcctgccctacaacctgcgcgcctcc
ttctgccgcctcatgctgcacatgcacgtggaccgcgagccccaggaggcagtggtggcc
gtgcgctacgcccgcctctggaccgagatcccctccaagatcaccatccacgagtatgag
tacgagttcactgacacctccagagaggagatgaagaggaagtttgcccccaccatggag
tttgtagaggaatacctcaaagacgtggtcagccagccctttccctttggagacgaagag
aagaatgaactgactctggaggtggtgcacctggcccgtaacctggtttattttggcttc
tacagcttcagtgagctgctgcgtctcacacgcaccctgctggccatcctggactttgtc
cagcacccgcttaccgacatggccgagctcagcaagagccccgaggcagggaacaacgtg
tttcgtaccatccacggtgtgggagagatgatgactcagatggtgctgagtcgagggcac
gtccagcctcaccacctcccgaacacgcccccgtcccttcaggacagaaaacaaccactc
tgtctgacagacaacgaggatgtcatggtcatggacaccaagctcaaaatcatcgagatt
ttacagtttattctgagtgtgcgactggactataggatcacctacctgctgtccatctat
aagaaagagtttggggacagtaatctaccggacagctctatgtcattgtctgaatttccc
tccatgtcagtttcagatccagacattgacgagattgcagccaaagcagagacaatgttt
gctggaagttcagagtgtagtgctgtggagctggatgatgagggaggcaggaccttcctg
agggttctgatccatctcatcatgcaggactacaccccgctggtgtccggctcactgcag
ctcatgttcaaacacttcagccagagagccgaggtcctacaggccttcaaacaggtgcag
ttgctggtgtcggagcaggatgtggagaactacaagcagatcaagaccaacctggaccag
ctcaggctggcggtggagaagtctgaactgtgggtggagaagagtggaggctacggaaat
gaggacataggagacagccaggtcaaggagcagaccatggaggaggcgggcatcctgagt
ccagtacaggatggggatgtgaagccccatatagacagcaacaaagccaacaactacaac
atcgtcaaagagatcctgctgcggctcagtaagctgtgttaccccagtaagaagagttgt
gtgcagcagcagaggctgctgaagaacatgggggctcactctgtggtgctggacctgctc
cagataccttatgagaagagtgatgcgaagatgaatgagatcatgaccctggcccatgtt
ttcctgcagtacttctgtagagggaacagtcagaaccaggctctgctccacaaatacctc
aacctgttcctttcaccagggctcctggaggctgagaccatgcgccacatcttcatgaac
aacttccacctgtgcaacgagatcagcgaccgcgtggtccaccattttgtccactgcatt
gagacgcacggccgacacgtccagtacctcaagttcctcctgaccatcgtcaaggccgac
gggaagtacgtgaaaaagtgccaggacaaggtcatgaccgagctggtgaacggtggcgag
gacgtgctggtgttctacaatgaccgctcctccttcccggtgctgttccagatgatgtgc
tgcgagctggagcgtagggacgaggacggcgccctggcctaccacaacaccctggtagag
ctcctcgccgtctgcaccgagggcaagaacgtctacaccgagctgaaatgtaactccctg
ctgcccctcgacgacatcgtcaaagtggtcacccacgaagactgcatccctgaggtgaag
acggcctacgtgaactttgtgaaccactgctacgtggacacggaggtggagatgaaggag
atctacaccagccaccacatctggaagctctttgagaacttcctggtggacatggcacgg
gtgtgcaacagcaccacggaccgtaaccatgccaacgttcccctggagaggtacgtgacg
gagacggtgatggccgtcgtcaagggcttctttagctcccagttccctgtgaacaactcc
aacctgcagacccaccagcccatcttcatccagctgctccagtcctccttcaggatctat
aactgcacctggatcagctcagcccagaagaacaacatcgagggctgcatcaaaacactg
gctgacgtggccaaggcgcgtgccattgccatcccggtggatctggacagccaggtgaac
actctgtctctgaaggcccacacctacagggtggagcgtgctgtcaaggactggaggacc
tcagcacgcacacggctccgcaaggagatcctgggagtgcctgactacaagagcatcatc
gagaagctgcagggtgtggtggcgtgtctagaggagcagttcagtcctatggtgcaggct
gagttctctgtgttggtggatgtactacacagccctgagctgctgttcccagaggctgcc
agactgcgctgtgagagcggggccttcatgtccaaactgatcaaacacaccaagaagctg
atggacaaggaggaaaagctgtgcattaagatcctgcagacactccgagagatgctggtc
aagaaggaggcctttgatgagcctggaaacgtgttaaggaagattctcctcactcgctac
tttggaaagaaaaggcttcactccaaatcagagtttgggagcgggaatagctcagctgga
ggtggctctctggtgcaggactctgacaagttgagcagcagcatggtagatatccagtgt
ctactggacagtgagggagcctcagagctggtcatagaccttatcgtcagcaccaagaac
gactgcatgttcgaggagagcatcctgctaggcaacgccctgctccaggggggaaacact
cagatacagaactcattctaccaccagctgcacaagcagaagaagtcggagcacttcttc
aaggtgttctacgaccgcatgcgtctggcccagcaggagatccgggccactgtgtccgtc
aacatgttcgaggtcagcacctgcaggaagagagacgaggacgtcgacgtcagttacagt
ggcatccgtctcaggaaaacgccaaaagactcttccctgcacatggtagacaacatgcgt
ggccagttgaaggaggcgtcctcggccacctccaaggcctttgtctccttccggaaggag
cgggacacggacctggaggtcctggagggccaggccggtgaggggcccgggggaggggca
gaggagagggaggaggaggcccagatgagccgggccatcaccatcatgaagcctatccta
cgctacctgcagctgctctgtgagaaccacaacagggacctgcagaacttcctgcggaac
cagaacaacaagaccaactacaacctggtgtgtgagacgctgcagttcctggacatcatg
tgtggcagcaccactggaggcctgggcctcctgggcctctacatcaacgagggcaacgtg
gacttagtccggcagaccctggagaccatcacagagtactgccaaggaccctgccacgag
aaccagtcctgtatagccaagcacgagtccaacggcatcgacatcatcatagctctaata
gtcaaccccgtcaacccattagggaagcatcgactggacctggtactggaactcaagagc
aacgcctccaagctgctgctggcaatcatggagagtcgccatgacagcgagaatgccgag
aagatcctttacaagatgagacccatggagctggtggatgtgatgaaggaggcatatgcc
caggggctggaaagtgaggctgaggagaacgctataggagaccagatcaaacctaaagac
gtaggacacaacatctacatcctggcccaccagctggccagacacagtaagttcctgcag
cagagcttgaggccgccagcgacggggctattgctgagccataaaatagagggagaagac
gccctcagttactatgccaaccacaccgctcagatagagattgtgcgtcacgaccgcaca
atggagcaaatagtgttcccagtgcccaacatctgtgagtacctgacagaggagtccaaa
acgcgagtgttcaccaccaccgagagggacgaccaaggcagcaaggtcaatgacttcttc
acgcagttcgacgacctctacaacgagatgcgctggcagaagaagatacgcaataacctt
gctctgttctggttctctcggcacatctctctgtggggaagcatctctttctacctggca
gtgctggtcaacgtggccgtggctctcttctaccccttcggtgacggcgaagatgaaggc
atcctgcccccctttgtatccatcctgctgtgggtggcgttggtggtgtgtaccaccatg
ctcttcatccttcccaaaccagggagtgtccggcccttcctggtctctgtcatactgcgc
tccatctacacactgggcctggaccccaccctgttgttactgggcgccgccaacctcctc
aataagattgtgttcctggtgagcttcgtgggcaaccaggggacgttcacacggggctac
aagccggtggtcatggacatgcccttcctctaccacgtgggctatgtcatcgtctgtatg
ctgggcctcttcgtccacgagttcttctacagcttcctgctctttgacctgctgaaccgc
gaggagaccctgctgaatgtggtcaagagtgtgacgcgtaatgggcgctccattgtcctc
acagctgtactggccctcatcctggtctacctcttctccatcgtgggcttcctcttcctt
aaggacgacttccgcatggacgtgcaacgtctgccagtgatggcgggggaggacgatggg
acggagcgtgtgtgtgacactctgctgatgtgtatcgtgacggtgctgaaccagggcctg
aggaacggagggggagtgggagacgtgctgaggaaaccttccaaagacgatcctctgttt
gtggcccgtgtggtgtatgacctgctgttcttcttcatcgtcatcatcatcgtcctcaac
ctcatcttcggcgtcatcatcgatacgttcgctgacctgaggagcgagaagcagaggaag
gaggagatactgaagaccacctgcttcatctgtgggttggagagggataagtttgacaac
aagacggtgtcctttgaggagcacatcacgtcggaacacaacatgtggcactatctgtac
ttcctggttctggtgagggtgaaggaccccacagagtacaccggcccagaaagctacgtg
gcccagatgatcaaggaaaagaacctggactggttcccccggatgcgggccatgtctctg
gtgagcagcgagggggagagtgagcagaacgagatgcgctccctacaggagaaactggat
ggcaccgtcaaactagtgtccctgctgtcttcccagctgttcgagctaaaggagaagatg
acagagcaaaggaagaataaacagaggctgggcttcctggggactcatggagtcaacaac
caccatatcccagcacactga

DBGET integrated database retrieval system