KEGG   Salmo salar (Atlantic salmon): 106573365Help
Entry
106573365         CDS       T04363                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK1-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106573365
   01009 Protein phosphatases and associated proteins [BR:sasa01009]
    106573365
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106573365
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: Other
  Wnk family
   106573365
Protein phosphatases and associated proteins [BR:sasa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106573365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 106573365
NCBI-ProteinID: XP_014003827
UniProt: A0A1S3MKV7
Position
ssa16
AA seq 1929 aa AA seqDB search
MSEKPNDKMKFLAPLSKSGNGNINNGSGSDSLVGERVAVELRHRHHTMERDRCPAEYRPF
FRRSVISDSNATALDLPLPSTIPIFTPIEPPVQDVSHPAGPPPTPRPAPRVTVTESEGGE
VKVDVSVEQKAAVVQDICDGEAVAQPANRLAAQPPSQTTEPGSGDEVKEREEGEEEKEKA
RVEAEQREAEKKVQDDIEEAETKAVGTSPDGRFLKFDIEIGRGSFKTVYKGLDTETTVEV
AWCELQDRKLSKSERQRFKEEAGMLKGLQHPNIVRFYESWEAPVKGRKCIVLVTELMTSG
TLKTYLKRFKVMKIKVLRSWCRQILKGLHFLHTRAPPIIHRDLKCDNIFITGPTGSVKIG
DLGLATLKRSSFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEYPYSECQN
AAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQEETGVRV
ELAEEDDGEMEAIKLWLRIEDVKKLKGKYKENEAIEFSFDLRKDVPEDVAQEMVESGYVC
EGDHKTMAKAIKDRVSLISRKREQRQQVREEQEKRRLEEEQGQRQQEQLILQQQSGTEAS
QPGQQAAPYTQPQPTQQPPQPNLQTTPDIPPQTAQLGPQGVPYIPQSTGQLPVPVSTQVL
AQPESEAPEVDQYPQQTETANQITDSSSILPEMHLVQPVVSYSSLPSQQPQPEAPYPQAT
PPVQTDQSQQQPQQTMVVPAAQTATVVPGAPQQQPQPVGSAVPQSTALPPLQPGAQQIQS
WANEPSPPILSPPINAEHLYFLYQAANLSVLQASVSVFQPVSAERSAAGQTALVPQSVEN
CLSNVLSGLSDGYEGTSDGRHEGRSMIKRHQQHSVRSHSCHEKTAKAKLIVLNISNMGDR
VAECQLETHNRKMVTFKFDLDGDNPEEIARIMVLSKFILESERKSFIEQVREVIEMPDDK
GEGMKEGYAQPPFTQIVVDDPLQQRDKPTPLSGVAAQVVHSAGRRFIVSPVPESRLREQF
FGPPSANTSFGDEPHPVSLGLSLSAPSSRLQQAFTEMRETHGERRATSTVPSSQAGLHPT
PTTSSTLPHVSVIPSGSSSLPSSTCQVATGRVSPTPVPAPATSELIPHPQPGCQAAPAQI
TSPPSAALQHPQATSSSFPPASADQMGSSSAPVSGAPPSNSGTVTSSEQHLVPILSSQPV
PVSVPVTQPTSSQSQPVPVSVPVTQPTSSQSQPVPVSVPVTQPTSSQSQPVPVSVPVTQP
TSSQSQSQPVPTFVPVAQPAMAPTQLPPSTLASQPSQLQPGDPDGGESKAPGIDDIHALE
KKLRSLFKDTTSADPGNTETTSSSTETISPPHLAALVPPFNLSLTSGEQGAPGPPSNPGQ
GLTPAEHAQIHPEQHGQATRAQAGTPTSEQLPPFPVPNQSQQPLGSLDGQLRRAVSPETI
PGSSRATMPSTGFVKLGRFQVSEAGAGSTPDPSTIASSSSLTPSSSSSSSSSSSSFSSPE
NTLHRSSSLSKGVWSGDSVDGLTSVPTQPATIGRFQVTASVTPSPNSVSKVGRFSVTPAA
ANTTAPSGSSLSHQNGPSSSTTSDPCSSASGVNRGLFNHYMTSDNEDDSGPEDEAFEREV
SRLREKHMIEIQTLHSHHKEEIDALFTRLGKPRPSAVLSPSVAMAGGRRRAKTKASKSAR
SSTQPGPLHSGAQVTGQTSPESSPKQTSRPTAGLSEPGSRTSLQNLKLSPSLPSLSTSTM
GVSGTSSDSGANTSRSQPSGPNMAPALTQSRKGTFTDDLHLLVDNWARDAISLSHVKKGP
KGTSQGPGHDIPLHIPPQANMGRKFSAPGHLCPTTHPSTNPSSIPLCPRQGSLGTSAQVF
GYGPSTYSTPQWAGPTGPCQVGLLASTQPQAQYQPQAPSSASAPLQQAFHVGATQKPVSN
PGGPNLRPT
NT seq 5790 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaaagcccaacgacaagatgaagttcctggctcccctttccaagagtggtaat
ggcaacataaacaacggatctggctcggactcactagttggtgaaagggtggcagtggag
ctgaggcaccgccaccacaccatggagcgcgatcgctgccctgccgaatatcgaccattc
ttccgccgcagcgtcatcagcgactccaatgccaccgcccttgacctccccttacccagt
acaatccctatcttcacgcccattgaaccccccgtgcaagatgtgtcccatcctgccggt
ccaccccccaccccaagacctgcaccccgtgtgactgtgacggagagcgaaggaggagaa
gtgaaggtagatgtgtctgtagagcagaaggctgccgtagtacaagatatctgtgatggg
gaagcagtggctcagccagcaaaccgtctagctgcccaaccgccaagccaaacgacagaa
cctgggagtggcgatgaagtgaaggagagggaagagggggaggaagagaaggagaaagcc
cgggtggaggctgaacagagagaggcagagaaaaaggtgcaggatgacatcgaggaagca
gagacgaaagcggtgggaacgtcgccggatgggcggttcctgaagtttgacattgagatt
ggacgtggttccttcaagactgtctacaagggcctggacacagagaccacagtggaggtg
gcatggtgtgagctgcaggaccgtaagctgtccaagtcggagcgccagcggttcaaagag
gaggcgggcatgctgaaggggctgcagcaccccaacatcgtccgcttctacgaatcctgg
gaggcccccgttaaaggcaggaagtgcattgtgctggtcacagaactcatgacctccgga
acactgaaaacgtatctgaagcgtttcaaggtgatgaagattaaggttctgaggagctgg
tgtcggcagatcctgaaggggctgcacttcctccacaccagggcccctcccatcattcac
agggacctgaagtgtgacaacatcttcatcaccggccccacaggctccgtcaagattgga
gacctgggattggccacactcaagaggtcctctttcgccaagagtgtcataggtacccct
gagttcatggcgcctgagatgtatgaggagaagtacgacgagtcagtggatgtgtatgcc
tttgggatgtgcatgctggagatggccacctcagagtacccatactccgagtgccagaac
gctgcacagatctaccgcagagtcaccagcggggtgaagccggccagcttcgacaaggtg
gccatccctgaggtgaaggagatcatcgagggatgtatccgacagaacaaggacgagagg
tactcgataaaggacctgctgaaccatgccttctttcaggaggagaccggggtgcgtgtg
gagctggctgaggaagatgacggggagatggaggccatcaagctgtggctgaggatagag
gacgtcaagaagctgaaggggaagtacaaggaaaacgaggccatcgagttctccttcgac
ctcaggaaggacgtccccgaggacgtggcccaggagatggtggagtctggctacgtgtgt
gaaggggaccataagaccatggctaaggccataaaggacagggtttccctcatcagcagg
aagagggagcagaggcaacaggtgagagaggagcaggagaagaggaggctggaggaggag
cagggccaacgacaacaagaacaactaatactacagcagcagtccggcacagaggcctcc
cagccaggccaacaggctgccccctacacccagccacagcccacccagcagccaccacag
cccaacctgcagactacacccgacatcccccctcagacggcacagctggggccccaggga
gttccctacataccccagtctacagggcagctcccagtcccagtatcaacccaagttcta
gcccagccagagtcagaggcgccagaggtggaccagtacccgcagcagactgagacggcc
aatcaaataacagatagttcctccatccttcccgagatgcacctggttcagccggtggtg
tcatacagctctctgcccagtcagcagcctcagccagaggccccatacccacaggccaca
ccccctgtccaaaccgaccaatcgcagcagcagccgcagcagaccatggtggttcctgct
gcccagactgccactgttgtccctggggctccacaacagcagccacagccagtgggcagc
gctgtacctcagagcacagcactaccaccgctccagcctggtgcccagcaaatacagtca
tgggccaatgaaccgagccctcctatcctatctcctccaatcaacgcagagcacctctac
ttcctctatcaggccgcaaacctctctgtgctgcaggcctctgtgagtgtattccagccg
gtgtcagcagagaggtcagcagcaggacagacagcgctggtgcctcagtctgtggagaat
tgcctttcgaacgtgttgtcaggtttgagtgacggctatgaggggacatcagacggtaga
cacgaagggcgctctatgatcaagcggcaccagcagcactctgtacgcagccactcttgc
cacgagaagaccgccaaggccaagctcatcgtcctcaatatctccaacatgggagaccgg
gtggcagagtgccagctggagacccacaacaggaagatggtcacctttaagttcgacctg
gatggagataaccctgaagagatcgcacggatcatggtcctgagtaagtttatcctggag
agcgaacgcaagtcgttcatcgagcaggtccgggaggtcatcgaaatgccggacgataaa
ggagagggcatgaaggaaggctacgctcaaccgcccttcactcagattgtggtagatgac
cccttacagcagcgtgacaagcccactcctctgtctggcgttgcagctcaggtggtccac
tctgcaggccggaggttcatcgtcagccctgtcccagagtcccgtctgagagagcagttc
tttggtcctccctcggctaacacctcgtttggggacgagccccatccagtgagtctgggc
ctgtccctgtctgccccctcaagccgcctccagcaggccttcactgagatgagggagacg
catggggagagacgagccaccagcacagtcccctcctcccaggctggtctgcacccgacc
cccaccacctcctccaccctgcctcatgtctctgtcatcccctctgggtcctcctctctt
ccctcctccacatgccaagttgccaccgggagggtgtctccaaccccagttccagcacct
gctaccagtgagctaattccacacccccagcctggctgccaagctgcccctgcccaaatc
acatcccccccttcagctgctctccagcacccccaggccacctcgtcctctttcccccca
gcctctgccgatcagatgggcagcagctctgcccctgtctctggagctccacccagtaac
tctgggactgtgaccagctcagagcagcatcttgttcctatcctgtcctctcagcctgtc
cctgtgtccgttcctgtcactcagcccacctcctcccagtctcagcctgtccctgtgtcc
gttcctgtcactcagcccacctcctcccagtctcagcctgtccctgtgtccgttcctgtc
actcagcccacctcctcccagtctcagcctgtccctgtgtccgttcctgtcactcagccc
acctcctcccagtctcagtctcagcctgtccctacctttgtccctgtggcccagcctgca
atggcccccacccaacttccaccctctaccctggcctcccaaccgtcccagctgcagcca
ggggacccagatgggggagagtccaaggcccctggtatagatgacatccatgccctagaa
aagaagctgcgctccctctttaaggacaccacctccgctgaccctggcaacactgagacc
acctcttcctccacagagaccatctcccctccccatctggcggccctggtgccccccttc
aacctgtccctcacttcaggggaacagggagccccaggccccccctccaacccaggacag
ggcctcacaccagcggaacatgcacagatccatccagaacagcatggccaagccaccaga
gcgcaggcaggcacccctacctctgagcaattgcctccattcccagtaccaaaccagtcc
cagcagcctcttggcagtctggacggccagctgaggagagctgtgagccctgagaccatc
ccagggagcagtagagcaacaatgccctccacagggttcgtcaaactgggacgcttccag
gtctcagaagctggcgccggcagcactcctgacccctctaccatcgcctcctcttcctct
ctcacaccctcttcgtcctcctcctcttcttcctcgtcttcctccttttccagcccagag
aacaccctccaccgctcctcctcgctctccaaaggagtctggagtggagactccgtagat
gggctcacttctgtcccaacgcagccagccaccatcggacgcttccaggtgactgccagt
gtcacacccagccccaactctgtctccaaagttggccgtttctcagtgacgccagctgca
gccaataccacggctccttcgggatctagcctctcccatcagaacggcccttcctcttcg
acaacctctgacccctgtagctccgcctccggcgtgaacagaggtttgtttaatcattac
atgaccagcgacaacgaggacgactcggggccagaggacgaggcctttgagagggaagtc
agccgcctccgagagaaacatatgatagagatccagaccctccactcccatcacaaggag
gaaatcgatgctctgttcaccaggctgggtaaacctcgtccatcggctgtcctctccccc
tctgtggccatggccgggggccgacgcagggccaagaccaaggccagcaaatcagcccgc
agcagcacccagcccggtcccttgcactcaggagcccaagtcacaggccagacctcccca
gagtcctccccgaagcagacgtctcgccccacggcagggctctctgagccaggcagccgg
acctccctccagaatctcaaactctccccctctttgcccagcctcagcacctccaccatg
ggagtgagtgggaccagttcagacagtggagcgaacaccagccggtcccagccgtcaggc
cctaacatggccccggccctaacacagagtcgcaagggcacattcacagacgacctgcac
ctgctagttgataactgggcccgagacgccatcagcctctcccacgtcaagaaaggaccc
aaggggacatcccagggacccggacacgacatccctctacatatccctccacaagccaac
atgggcagaaagttttctgcccccggccacctctgccctactacccacccctccaccaac
ccctcctccatccccctctgcccgcgtcagggctctctgggcacctctgcccaggtgttc
ggctacggcccatccacctacagcaccccccagtgggcaggacctacaggtccctgtcag
gtaggcctcctggcctccacccagccgcaggcccagtaccagccccaagccccctcctcg
gcctcagccccccttcagcaggccttccacgtgggagccactcagaaacctgtcagcaac
cctggaggccccaacctgaggcccacgtag

DBGET integrated database retrieval system