KEGG   Salmo salar (Atlantic salmon): 106576243Help
Entry
106576243         CDS       T04363                                 

Gene name
MK12
Definition
(RefSeq) mitogen-activated protein kinase 12-like
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04010  MAPK signaling pathway
sasa04068  FoxO signaling pathway
sasa04218  Cellular senescence
sasa04261  Adrenergic signaling in cardiomyocytes
sasa04370  VEGF signaling pathway
sasa04620  Toll-like receptor signaling pathway
sasa04621  NOD-like receptor signaling pathway
sasa04622  RIG-I-like receptor signaling pathway
sasa04625  C-type lectin receptor signaling pathway
sasa04912  GnRH signaling pathway
sasa04914  Progesterone-mediated oocyte maturation
sasa04933  AGE-RAGE signaling pathway in diabetic complications
sasa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106576243 (MK12)
   04370 VEGF signaling pathway
    106576243 (MK12)
   04068 FoxO signaling pathway
    106576243 (MK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    106576243 (MK12)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    106576243 (MK12)
   04621 NOD-like receptor signaling pathway
    106576243 (MK12)
   04622 RIG-I-like receptor signaling pathway
    106576243 (MK12)
   04625 C-type lectin receptor signaling pathway
    106576243 (MK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    106576243 (MK12)
   04914 Progesterone-mediated oocyte maturation
    106576243 (MK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106576243 (MK12)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106576243 (MK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    106576243 (MK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sasa01001]
    106576243 (MK12)
Enzymes [BR:sasa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     106576243 (MK12)
Protein kinases [BR:sasa01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   106576243 (MK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 106576243
NCBI-ProteinID: XP_014008784
UniProt: B5XCI4
Position
ssa17
AA seq 364 aa AA seqDB search
MSVRTRTGFYRQEVNKTAWEVPERYRELKQVGTGAYGTVCSAQDHRTGVRVAIKKLHRPF
QSKLFAKRAYRELRLLKHMKHENVIGLLDVFTSEISLDRFHDFYLVMPFMGTDLGKLMKM
ERLSQDRVQFLVYQMLKGLKYIHSAGIIHRDLKPGNLSVNEDCELKILDFGLARQTDTEM
TGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMLLGKPLFKGNDHLDQLKEIMKIT
GTPTADFVTKLQSQDAKNYIRSLPKVPKKDLHFLFSKASSDAVCVLERMLLLDPERRVSA
SEALAMPFFSEFREPEEETEAQPYDHSMDNTDLLLEQWKRYTFTEILSFRPAATEIKDPK
ETSL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtccgcacgcggacaggattttaccgtcaggaggtaaacaaaacggcatgggag
gttcccgagcgataccgcgagctaaagcaggtggggactggcgcgtatgggacagtatgt
tccgcccaggaccacaggactggggtgagggtggccatcaagaagctccacagacccttc
cagtcaaagctcttcgccaagagggcctacagagagctccgactcctcaagcacatgaag
cacgaaaatgtgattggactgctggatgtgttcacttctgagatctcattggacaggttt
catgacttttacctggtaatgccattcatgggtactgatctggggaaactgatgaagatg
gagagattgtcacaggacagggtgcaattcctcgtctatcaaatgctgaaaggactcaag
tatatccactctgcagggatcatccacagggatctcaaacctggaaatttatctgtcaac
gaagactgcgagctaaagatccttgacttcgggctggctcggcagacggacacagagatg
acggggtacgtcgtcactcgctggtacagagcccctgaggtaatcctcaattggatgcac
tatacccagactgtggatatctggtcggtgggctgcatcatggcggagatgctgctgggg
aagccgctgttcaaaggaaatgaccacctggaccaactgaaagagatcatgaagatcact
ggtacacccactgcagactttgttacgaagctacaaagccaagatgccaaaaactacata
cggagccttcccaaagtaccaaagaaagatttgcactttcttttttccaaagctagctca
gacgcggtgtgtgtgctggagcgcatgctgttgctggaccctgagcggagggtgagtgcg
tcggaggcgctggccatgccctttttcagcgagttcagagaaccagaggaggagactgag
gcccagccctacgatcactccatggacaacacagacctactcctggagcagtggaaacgt
tacacattcacagagattctgtccttcaggcctgcagcaacagagatcaaggaccccaaa
gagacatcactctga

DBGET integrated database retrieval system