KEGG   Salmo salar (Atlantic salmon): 106577841Help
Entry
106577841         CDS       T04363                                 

Gene name
gba2
Definition
(RefSeq) glucosylceramidase beta 2
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00511  Other glycan degradation
sasa00600  Sphingolipid metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106577841 (gba2)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    106577841 (gba2)
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     106577841 (gba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N Bac_rhamnosid6H
Motif
Other DBs
NCBI-GeneID: 106577841
NCBI-ProteinID: XP_014011680
UniProt: A0A1S3N887
Position
ssa18
AA seq 885 aa AA seqDB search
MESGDNSSTAELMSRYLSSELGYGVPKDGWRICLAHEFKEKRKPFQAKDVSLSNIVEHIG
LGVRYLTWWYKKTQIEKKAPFIDMFRAIPLRQIYGAPLGGIGGGTITRGWRGEFCRWQLN
PGMYHYKTVIANQFTVCLRRGGQTVYQQVLSVERPPTLQGWNWGYCGEYAFYHALYPRAW
TVYPLPGQNVTLTCRQVSPVIPHDYQDSSLPVAVFVWDIENKNDYPLDVSIMLTMVNGSG
HKDDKSGGHWNEPFHLEKEGESVSGVLLHHCTTVNPYTLCMAAREQSDREISHQTAFSPK
GTCGALWSDLITDGRLDSPTGSNPPTQKGEKVAAALAVGCSVPAQGHNDLEFSLAWDMPN
ITFGSREREHVRRYTRFFGTKADAAPSLSHYALTHYRLWERSIEEWQRPILQDSSLPSWY
KSALFNELYFVVDGGTVWTELPEDSDVSGGLRSEDGGLPAQPAIIKEYGRFAYLEGQEYR
MYNTYDVHFYASFALIMLWPKLALSLQYDIAGSVVSCDPTERLHLMSGRNSPVKVKNVVP
HDIGDPDDEPWQRVNAYLIHDTADWKDLNLKFVLQVYRDFHLTQDTQYLQDMWPICQAVM
ESEMKFDTDGDGLIENSGYADQTYDGWTATGPSAYCGGLWLASVCVMCKMARLVNNEAAF
QHFRDILDRGSAAFDKLLWNGRYYNYDSSGQDLSNSVMSDQCAGQWFLRASGLGDGQFQA
FPKEKICSALKSVFDLNVMSFAGGQMGAVNGMRPEGVPDHSSVQSDEVWIGVVYGLAAIM
IHEGMLEEGLRTAEGCYRTVWERLGMAFQTPEAYCEKGIYRSLAYMRPLSIWAMQLALDT
SPPRDQSPQTTTTPTDQAPQTTTTKPTETEGEPGQKESRDQGHIQ
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atggagtcaggtgacaacagctcaacagccgagctcatgagtcggtatttgtcttcggaa
ctcggctatggggtaccgaaggacggctggcggatctgcttggcgcatgagttcaaggag
aaaaggaagccgtttcaagccaaagatgtgtccctctccaacatcgttgaacacattggc
cttggagtcaggtatctcacgtggtggtataagaagactcaaatagagaagaaggctcct
ttcattgatatgttccgagccattcccctgagacagatctatggtgcccctctaggcggt
ataggaggaggtaccatcacgcgaggctggcggggggagttctgcaggtggcaactcaac
cctgggatgtaccactacaaaactgtaatcgctaaccagttcacggtgtgcctgcgtcgg
ggcggtcagacggtgtaccagcaggtgttgtcagtggagcgcccccccacgctgcagggc
tggaactggggctactgcggagagtacgccttctaccacgccttgtacccccgggcctgg
acagtctacccccttcctgggcagaacgtcaccctcacctgtagacaggtgtcacccgtc
atcccccacgactaccaggattccagtctcccagtggcggtgtttgtgtgggacatagag
aacaagaatgactacccgttggacgtctcaatcatgctcaccatggtcaatgggtcaggc
cacaaggacgacaagagcgggggccactggaatgaaccattccacctggagaaggagggg
gagtcagtgtctggagttttgcttcatcactgcaccacagtgaacccctacactctgtgc
atggcagcgcgagaacagtctgacagggagatcagtcaccagacagcgttcagtccaaag
ggaacctgtggggcgctgtggagtgacctcatcactgatggacggctggactcccccact
ggttccaatcctcccacccagaagggagagaaggtggcagcagccctggcagtgggctgt
tcagtgccggctcagggccacaacgatctggagtttagcttggcgtgggacatgcccaac
atcacatttggctccagggagagggaacacgtcaggaggtacacgcgtttctttggtacc
aaggcggacgctgctccctctctcagccactacgcgctgacacactacagactgtgggag
aggagtatcgaggagtggcagagacccatactgcaggacagctctctcccgtcctggtac
aaatcggctctgttcaacgagctatacttcgtggtggacggggggactgtgtggacggag
ctgcctgaggacagcgatgtcagtggggggctgcggagtgaggacggggggctacccgcc
cagcctgccatcatcaaggagtacggtcgctttgcctacttagagggtcaggagtacaga
atgtataacacatacgacgtgcacttctacgcttcctttgcacttatcatgctatggccc
aaactagccctcagcctgcaatatgacattgctggcagtgttgtttcgtgtgacccgact
gaaagactccatctgatgagtggcagaaattctcctgtgaaggttaagaatgtagtccct
cacgacataggagacccagatgacgagccgtggcagcgtgtcaacgcctacctgatccac
gacacggccgactggaaggacctgaacctgaagtttgtcctgcaggtctacagagacttc
cacctgacccaggacacacagtacctccaggacatgtggcccatctgccaggccgtgatg
gagtcagagatgaagtttgatacggacggagacggtctgatagagaactccggctacgcc
gaccagacctacgacggatggaccgcaacaggacctagtgcgtactgtgggggtctgtgg
ctggcctctgtgtgtgtgatgtgtaaaatggccaggctggtgaacaatgaggctgccttc
cagcacttccgagacatactagaccgggggagcgccgccttcgacaagctgctgtggaat
ggccggtactacaactacgacagtagtgggcaggatctctccaacagtgtgatgtcagac
cagtgtgctggccagtggttcctacgggcatctggattgggagatggccagtttcaggcc
tttcctaaggagaagatttgcagtgcactgaagtctgtgtttgacctgaacgtgatgagt
ttcgctgggggtcagatgggtgcggtcaacggtatgaggccggagggggtacctgaccac
tccagtgtccagtcagacgaggtgtggatcggggtggtctacggactggctgctattatg
atccatgagggtatgttggaggagggtctacgtacagcagagggctgctaccggacggtg
tgggagcgtctgggcatggcctttcagaccccggaggcctactgtgagaagggcatctac
cgctccctggcctacatgaggcctctcagcatctgggccatgcagctggccctggatacc
tcaccaccacgagaccagtccccccagaccaccaccacacctactgaccaggccccccag
accaccaccacgaaaccaactgagactgagggagaaccaggacagaaggagagtcgggac
cagggtcacattcagtag

DBGET integrated database retrieval system