KEGG   Salmo salar (Atlantic salmon): 106578013Help
Entry
106578013         CDS       T04363                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106578013
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:sasa04030]
    106578013
G protein-coupled receptors [BR:sasa04030]
 Rhodopsin family
  Lipid
   Leukotriene
    106578013
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Serpentine_r_xa 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 106578013
NCBI-ProteinID: XP_014012016
UniProt: A0A1S3NA75
Position
ssa18
AA seq 400 aa AA seqDB search
MASDLSISAAPPLLPSTPSLVSSSPPLSISHQIGISILVLAFVFGFPGNLFVVWSVLCRV
RHRSVTCLLVLNLAAADALVLLSAPLFLHFLAGRRGWEFGAVACKTVHYLCCVNMNVSIY
LICLMSMDRWLAVARPFLSQRMRTKTTLMAVLLGIWVLAFILALPMPFYRSNLKPFLHKN
ISMNICMPYHWGSVGHQVFQYLFETVLGFFLPFTFIIVCYTSVICRLRSAMFQRKGRGNR
LILLIIGAFALFWLPYHLVNILQVIGLLGGNATLTNAAVSARPNVTAFAFLSSSVNPVLY
VFAGSSHIRQAGLSFMAKLFEGTNSEGGTSASFSRSTRSSRSGSTAPDESSALRSLTLKL
GWLGKEKDGGGDSGVELRGVEVKVNSKQELKTLTSTDQSE
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagacctctccatctctgccgctccccccctgctcccctccaccccttctctt
gtctcctcctcccctcctctctccatctcacaccagatcggtatctccattctggtcctg
gcctttgtctttggtttcccaggcaacctgttcgtggtgtggtcggtgctgtgccgcgtg
aggcatcgctctgtcacgtgcctgctcgtcttaaacctcgccgcggccgacgccctggtg
ctgctaagcgccccgctcttcctgcacttcctggcaggcaggcgaggctgggagttcggg
gcggtggcctgtaagacggtacactacctgtgctgcgtcaacatgaacgtctccatctac
ctgatctgcttgatgagcatggatcgctggctggccgtggcgaggcccttcctgtcacag
aggatgaggaccaagacaaccctgatggctgttctgctgggtatctgggtgctggcattc
atcttagctctgcccatgcccttctatcgcagtaacctgaagcccttcctgcacaagaac
atctctatgaacatctgcatgccgtaccattggggcagtgtaggtcaccaggtgttccag
tacctattcgagaccgtcctgggcttcttcctccccttcactttcatcatcgtctgctac
acctccgtcatctgccggctacgcagtgccatgttccagcgcaagggacgaggaaaccgt
ctcatcctcctcatcatcggcgccttcgctctcttctggctgccctaccacctggtcaac
atcttacaggtgattggtctgctgggtggcaacgccactctcaccaatgctgctgtatcg
gcccgtcccaacgtcacggcgttcgccttcctgagcagcagtgtgaaccctgtgctgtac
gtgttcgccggcagctcccacatccgccaggccggcctcagcttcatggccaagctgttc
gagggcaccaactccgagggaggtacctccgcctccttctcccgcagcacgaggtccagc
cggagtggttccacagccccggacgagagctccgccttgcgctcgctgacactcaagctg
gggtggttggggaaggaaaaggatgggggtggggatagtggagtggagctgcgtggagtt
gaggtcaaggttaactccaagcaggagctcaagactttgacatccactgatcagtcagag
tag

DBGET integrated database retrieval system