KEGG   Salmo salar (Atlantic salmon): 106578953Help
Entry
106578953         CDS       T04363                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sasa  Salmo salar (Atlantic salmon)
Pathway
sasa00010  Glycolysis / Gluconeogenesis
sasa00562  Inositol phosphate metabolism
sasa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106578953
   00562 Inositol phosphate metabolism
    106578953
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106578953
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106578953
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106578953
NCBI-ProteinID: XP_014013739
UniProt: A0A1S3NE73
Position
ssa19
AA seq 461 aa AA seqDB search
MTSALSKQSLLFTTFSLALTRFSYCSVANANVNSNIPAIANHFGTKGRYEEVNSYLINDI
LSVNKSLLKPGCTNCTAIHVAAIIRHGTRYPSTKNIKMMQQLYDLVLNEAMNTNTWLKDI
KTKWEMWYTDDMDGKLVEKGRDDHRHLAVRLATLFPSLISEENLRAHRIRFITSSKHRCV
DSIVAFQEGLLNLWNVTEVRPSHKINDELMRFFDQCQKFVEDIENNQTALEEVHLFKASA
EMKRVQMKMADQLQVPYNRITPDLVEAAFFLCSYEFAIKSLNSAWCNLFDETDAQVLEYK
NDLKQYWKRGYGHDINRKSSCNLFHDLFNRLDQAAREIRFGHVSEAVTIQVGHAETLLPL
LALMGFFRDETALTADNFDVQNGRTFRTSRIVPYAANLLFVLYDCSEGLRLQFLLNETPQ
NFPDIMHQAPLYDTVRETYRELLHGCNFEKECELPRPNSEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgcgttatctaaacaaagtttgttgttcacgacatttagtcttgctttgacc
aggttttcatactgctcagttgcaaatgctaacgtcaattcaaacatacctgcgattgca
aatcattttggaacgaaaggcagatatgaggaggttaacagttatctcattaatgacatt
ctctcggtaaacaaatcccttttaaaaccaggatgtaccaattgcacggctattcatgtg
gccgccattattcggcatggtacacgatatccatcgaccaaaaatataaaaatgatgcaa
cagctttacgaccttgttctaaacgaggcaatgaatactaatacatggctgaaggatatc
aaaaccaagtgggaaatgtggtacactgacgacatggatggcaagcttgtggagaagggg
cgagatgaccataggcatctggctgtcaggttggcaacattgtttccatctctgatatcc
gaggaaaacctcagagcccaccgtatccgtttcatcactagctctaaacacagatgcgtg
gacagcattgtagcatttcaagagggcctgctcaacctttggaatgtgacagaagttaga
cccagccacaaaatcaatgatgagttgatgagattctttgaccagtgtcagaaatttgtt
gaggacatagagaacaaccaaactgccctggaagaggtccacctcttcaaggcctcagca
gagatgaaaagagtgcagatgaagatggctgaccagctgcaagttccatacaatcgcatc
acaccagatctggtggaggctgcattcttcctgtgctcatatgagtttgccatcaaatct
ttgaactctgcctggtgcaacctgtttgatgagactgatgcccaagtgctggagtacaaa
aatgacctgaaacagtactggaagaggggctatggtcatgatatcaaccgcaaatccagt
tgcaatctctttcatgacctgttcaatcgtcttgatcaggctgctcgtgagatcaggttt
gggcatgtatctgaggccgtgaccatccaggtgggtcatgccgagaccctcctgcccctg
ttggccctcatgggcttcttcagagacgagacggccctgactgctgataactttgacgtg
caaaatggccgcaccttccgtaccagccgcattgtgccttacgcagccaacctgctcttt
gtgttgtatgactgcagcgaaggactccggctacagttcctcctcaacgagacacctcag
aacttccccgacataatgcatcaggctccactctacgatacggtcagagagacctacaga
gagctgctgcacggctgcaattttgaaaaagagtgcgagctgcccagacccaactctgag
ttgtga

DBGET integrated database retrieval system