KEGG   Salmo salar (Atlantic salmon): 106579450Help
Entry
106579450         CDS       T04363                                 

Gene name
zdhhc23
Definition
(RefSeq) zinc finger DHHC-type containing 23
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106579450 (zdhhc23)
Enzymes [BR:sasa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106579450 (zdhhc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 106579450
NCBI-ProteinID: XP_014014835
UniProt: A0A1S3NHW1
Position
ssa19
AA seq 426 aa AA seqDB search
MKKRASKALELDEPLCCCEYVDRQGGRSHVAACCCDCEDLDDACDRWLKKEPQKADSLSR
LVTMVSDRLRVPWFWGGARRVDLSVLPPLLLLPVLLHIAALHLLLGMVVLTTLPVLVLWY
YYVIHRKKGRTLFFLSLALFSLGYMYYLFLTEVFPRGGVGLTQLGTVTLGVALTLASLIH
TKREPGYVRPHTADVHSTVTYHSSPLDRDPANTGLNGVGQEVVLANRGSGSEQQGQGVEQ
RESGRSRKWCSTCRVVRPPRAGHCRICGVCVLRLDHHCVWINSCVGQANHRSFLSTLLLF
LLTSLYGISLVLRSVCPQQNLLSALLYCPGVYNQYSSALCFTCAWYSSIVTGGLLHLLVL
QLINVSYNVTEREVRTALRDKTARSHYWGLVVDTGVYSHGFRGNWAEFLTMGEGLHTPSP
SLTDLV
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcgagccagtaaggcgttggagctggatgagcctctgtgctgctgtgagtat
gtggaccgtcagggggggcggagccatgtggcagcctgctgctgtgactgtgaggacctg
gacgatgcctgtgacagatggctgaagaaagagccccagaaggcagattcactgtcccgt
ctggttaccatggtgagcgaccgcctccgtgttccctggttctggggtggagcccggcgt
gttgatctatcggtgctgcccccgctgcttctacttcctgtcctcctacacatcgcagcc
cttcacttgctgttgggcatggtggttctgaccactctaccggtactggttctatggtac
tactacgtcatccaccgtaagaagggccggactctgttcttcctcagcctggccctgttc
tccctgggctacatgtactacctcttcctcaccgaggtcttccccagggggggtgtaggg
ctgacccagctgggtacagtgacccttggggtggccctcactctggcctcactcatccac
accaagagagagcccggctacgtacggcctcacacggccgacgtccacagcacagtgacc
tatcacagctcacctctggacagagaccccgccaacaccggcctcaacggggtcgggcag
gaagtggtgctagccaatcgggggagtgggtcggagcagcagggccaaggggtggagcag
agggagagtgggcggagcaggaagtggtgctctacgtgcagggtggtgcggccccccagg
gcgggacactgcaggatctgtggtgtctgtgtcctgaggctggaccaccactgtgtctgg
ataaatagttgtgtgggccaggccaatcaccgcagcttcctgtcgacactcctcctcttc
cttttgacctctctgtatgggatcagtctggtgctgcgcagcgtgtgtccccaacagaac
ctgctcagcgccctgctctactgcccaggcgtctacaatcagtacagctcggcactgtgt
ttcacctgtgcgtggtacagcagcatagtgacgggtggcctgctacacctgctggtcctg
cagctcatcaacgtcagctacaacgtgacggagcgagaggtgcgcaccgccctccgagac
aagaccgcccgcagccactactggggcctcgtcgttgacacgggagtctactcacatggt
ttccgtggcaactgggcagagttcctgacaatgggagaaggcctgcacacaccctcaccc
agtctcactgacttggtgtag

DBGET integrated database retrieval system