KEGG   Salmo salar (Atlantic salmon): 106579687
Entry
106579687         CDS       T04363                                 

Definition
(RefSeq) uncharacterized LOC106579687
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
KEGG Orthology (KO) [BR:sasa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sasa03000]
    106579687
Transcription factors [BR:sasa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106579687
SSDB
Motif
Pfam: PAS HLH PAS_3
Other DBs
NCBI-GeneID: 106579687
NCBI-ProteinID: XP_014015293
UniProt: A0A1S3NIQ1
Position
ssa19
AA seq 677 aa
MIPPGDCMYAGRKRRKPVQKQKPATVSEKSNPSKRHRDRLNVELDRLASMLPFSPDIISK
LDKLSVLRLSVSYLRVKSFFTVNHEKPSSRKHISPSTNSVSEPRKDSLPKAMGNSITESG
LLLETLTGFALVVSSDGMVFFSSSNIVDYLGFHQTDVMHQNVFDYVHVDDRHEFRRQLHW
AMNPSQHHLVSGTGEDFVVSSLFHSQETGGVAPEFSSFLNRCFMSRVRCLLDSTSGFLTM
QIQGRLKFLQGQKKKWGSGALLPPQLALFCVAVPLLLPSITEMKMNNMMMRGKHKSGGGI
ITALEYGEREEPLRRQAGSAGGMVDGGDPLLLNCTKLGGPQQRRHAPWTPLSKDSLKYKT
EGGYCGQDEPLNYCKTSMGGVPHHKGPGLDSLWPMRPASGPIRGGQSGGYTPSNRLGKGG
HYGKPYRMSPSMCHGGGRGGEIYVPRMYESLQSPGGLDLYCVGEAVKSECYGNLLFPEMP
IKVEQDSDSENGCDAYGRPWPCREPLDHRYHNGNSYVDNNGLHMKSEADYYEQYSPCQRG
KAGISPPYNNGHFQNYNNIGGSGSRPLKSVVNKDQSQFGPQRLSHSDPLCNCIDVYASDP
MDHNNKGYMQQQDKLDYEFKGHGPRHTIKQEPVDSPPWSDGSGHDMSHAMGHSQRNVTPN
RVMNAGQHKANPCVYMQ
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgatacccccaggagactgcatgtatgcgggcaggaaaagaaggaaaccggttcaaaag
cagaaaccagcgacggtgagtgagaagtccaacccgtccaagaggcaccgggaccgcctg
aacgtggagctggaccggctggccagcatgctacctttttccccagacatcatctccaag
ctggataaactgtccgtgctgcgtctcagtgtcagctacctccgggtcaagagtttcttc
acagttaatcacgagaagccatccagcagaaagcacatcagtccatccaccaactctgtc
tccgagcccaggaaagacagcctgcctaaggctatgggcaacagcatcacagagagcgga
ctccttctggagacccttactggttttgcgttggtggtgagcagcgatggaatggtcttc
ttctcctcctcaaacatcgttgactatttgggcttccatcagacggacgtgatgcaccaa
aacgtctttgattatgtccatgtggacgaccggcatgagttcagaagacagctccactgg
gccatgaaccccagccagcaccacttagtctcaggaactggtgaggactttgtggtgagc
agcctgttccattctcaggagacggggggagtcgctcctgagttctcctcttttctcaac
cgctgtttcatgtcccgcgtgcgctgcctgctggacagcacctctggcttcctgaccatg
cagatccagggccgactcaagttcctccagggccagaagaagaagtggggctcgggggcc
ctgctaccccctcagctggccctgttctgtgtggccgtgccccttctgctgccctccatc
actgagatgaagatgaacaacatgatgatgaggggcaagcacaagagtggagggggcatc
atcactgcactagaatatggtgagagagaggagccgttgaggaggcaggctggcagtgcg
ggggggatggttgatggcggggacccgcttctcctcaactgcaccaaacttgggggtccc
cagcagcgccgccacgccccctggacgcccctctccaaagacagcctcaagtacaagaca
gaagggggctattgtggacaggacgagcccctcaactactgcaagacctccatgggcggc
gtcccccaccacaaaggcccaggcctggactctctgtggcccatgcggcctgcctcgggg
cccatccggggggggcaaagtggcggctacaccccttctaatcgactcgggaagggtggg
cactatggcaagccctaccgcatgtcccccagcatgtgccacggaggagggcgaggtggt
gaaatctatgtgcccaggatgtacgagagcctccagagccccggcggcttggacctgtac
tgcgtgggagaggcggtgaagagcgagtgctacggaaacctcctgtttcctgagatgccc
atcaaggtggagcaggactcggattcggagaacggctgcgacgcgtatggccgtccgtgg
ccctgccgggagcccttggaccatcgctaccacaatggtaacagctatgtcgacaacaac
ggcctccatatgaagtcggaggcagactactacgaacagtactcgccgtgccagcgggga
aaggcgggcatcagcccgccctacaacaacggacacttccagaactataataacatcgga
ggcagtggcagcaggcccttgaagagtgtggtcaataaggaccagtcccagttcggtccc
cagaggttgtcccactcagaccccctctgtaactgcatcgatgtgtacgcaagcgacccc
atggatcacaacaacaagggctacatgcagcagcaggacaagttggactacgagttcaaa
ggtcacggaccgcgccacaccatcaagcaggagcccgtggactcacccccgtggtcggac
ggcagcggccacgacatgagccatgccatgggacactctcagaggaacgttacgcccaac
cgtgtgatgaatgctgggcagcacaaagccaacccttgtgtttatatgcaatag

DBGET integrated database retrieval system